KEGG   Rickettsia felis: RF_0924Help
Entry
RF_0924           CDS       T00252                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rfe  Rickettsia felis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(984883..985089)
Genome map
AA seq 68 aa AA seqDB search
MRQKLNRGEYLNAVGEMLRWVKAKGGVKLQGLVKRRAIERSLFLSEAGTASIANEIAVTS
NVVTDYLK
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
ttgcggcaaaaacttaatagaggcgaatacctaaacgctgtcggtgaaatgcttagatgg
gtaaaagctaaaggcggtgttaagctgcaaggcttggtgaaacgtagggctatagagcgg
tctttgtttttaagcgaagcaggtacagcctcaattgctaatgagattgctgtcacttca
aatgtagtaactgattatttaaaataa

DBGET integrated database retrieval system