KEGG   Rickettsia felis: RF_1020Help
Entry
RF_1020           CDS       T00252                                 

Gene name
pdhA
Definition
pyruvate dehydrogenase e1 component subunit alpha (EC:1.2.4.1)
Orthology
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
rfe  Rickettsia felis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RF_1020 (pdhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RF_1020 (pdhA)
   00020 Citrate cycle (TCA cycle)
    RF_1020 (pdhA)
   00620 Pyruvate metabolism
    RF_1020 (pdhA)
Enzymes [BR:rfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     RF_1020 (pdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1080826..1081806)
Genome map
AA seq 326 aa AA seqDB search
MDIKPKKYKPTKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQEAVISAVDT
VKQKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFDIPNKFYGGH
GIVGAQVPIGTGLAFAEKYNGTNNICFTFLGDGAVNQGQVYEAFNMAALWGLPVVYIIEN
NEYSMGTSVARSTFMRDLYKKGESFGIKGFQLDGMDFEEMYNGAKQAAEYVRENSFPLIL
EVKTYRYRGHSMSDPAKYRSKEEVEQYKERDPLVIIRKTILDNKYATEADLKEIEQSVKE
IVKEAVKFSENSPLPDEGELYTEVYC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggatattaaaccaaaaaaatataagccgacaaaggaagaatatataaaaagctttaaa
gatatgctactactgcgtcgttttgaagagaaatgtgggcagttatacggtatgggagaa
ataggcggtttttgtcatttatatataggacaagaagcagtaatttctgcggtagatacg
gtcaaacaaaaaggagatagtacaattactagctatcgtgaccatgctcatattatttta
gcgggaacagagcctaaatatgttcttgccgagcttatggggcgagctacaggctgctcg
aaaggtaagggtggttcgatgcatttatttgacataccgaacaaattttacggtggacac
ggtatagtcggagctcaagtacctataggcacagggcttgcttttgctgaaaaatataac
ggcacgaataatatttgctttacttttttaggtgacggtgcggttaatcaaggtcaagta
tatgaagcctttaatatggctgctttatggggtttacctgtagtttatattattgaaaat
aacgaatattcgatggggacgtctgtagcacgttctacctttatgcgtgatttatataag
aaaggggaatcgtttggaattaaaggatttcagctagacggtatggattttgaagaaatg
tataatggagctaaacaagcagccgagtatgttagagaaaatagctttccgttaatattg
gaggtaaaaacttatcgttatcgtgggcattcgatgtccgatccggcaaaatatcgtagt
aaagaagaagttgagcaatataaagaacgtgatccgctagtgataataagaaaaacgata
ctcgataataaatatgcaaccgaagcagatttaaaagaaatagaacagtcggtaaaagaa
attgtgaaagaagcagtaaaattttcagaaaactcaccactgcctgatgagggggagttg
tatactgaggtgtattgttaa

DBGET integrated database retrieval system