KEGG   Rickettsia felis: RF_1030Help
Entry
RF_1030           CDS       T00252                                 

Gene name
cycM
Definition
(RefSeq) cytochrome c
  KO
K08738  
cytochrome c
Organism
rfe  Rickettsia felis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RF_1030 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RF_1030 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1092248..1092775
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTASEQ
APVNIPELMKTANADNGREIAKKCLVCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatataaacccactctagagttacagcatcgc
ggctacagcgttgcggttcaagaatcatcagaaaatcaaaatactaccgcatcagagcaa
gcaccggtaaatataccggaattaatgaagactgctaacgccgataacggtcgtgaaata
gccaagaaatgtttagtgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcatagcagactataaatattctcct
gctctatcaaaactcggcggcgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtagctatgcaccaggaaccaaaatgtcctttgctggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system