KEGG   Rickettsia felis: RF_1030Help
Entry
RF_1030           CDS       T00252                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rfe  Rickettsia felis
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rfe00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rfe02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1092248..1092775
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTASEQ
APVNIPELMKTANADNGREIAKKCLVCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatataaacccactctagagttacagcatcgc
ggctacagcgttgcggttcaagaatcatcagaaaatcaaaatactaccgcatcagagcaa
gcaccggtaaatataccggaattaatgaagactgctaacgccgataacggtcgtgaaata
gccaagaaatgtttagtgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcatagcagactataaatattctcct
gctctatcaaaactcggcggcgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtagctatgcaccaggaaccaaaatgtcctttgctggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system