KEGG   Rickettsia felis: RF_1030Help
Entry
RF_1030           CDS       T00252                                 

Gene name
cycM
Definition
(GenBank) Cytochrome c
  KO
K08738  cytochrome c
Organism
rfe  Rickettsia felis
Pathway
rfe01100  Metabolic pathways
rfe01120  Microbial metabolism in diverse environments
rfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RF_1030 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Senescence_reg SDF
Motif
Other DBs
NCBI-ProteinID: AAY61881
UniProt: Q4UKP6
Position
1092248..1092775
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTASEQ
APVNIPELMKTANADNGREIAKKCLVCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatataaacccactctagagttacagcatcgc
ggctacagcgttgcggttcaagaatcatcagaaaatcaaaatactaccgcatcagagcaa
gcaccggtaaatataccggaattaatgaagactgctaacgccgataacggtcgtgaaata
gccaagaaatgtttagtgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcatagcagactataaatattctcct
gctctatcaaaactcggcggcgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtagctatgcaccaggaaccaaaatgtcctttgctggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system