KEGG   Rickettsia felis: RF_1093Help
Entry
RF_1093           CDS       T00252                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoamide acetyltransferase component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rfe  Rickettsia felis
Pathway
rfe00020  Citrate cycle (TCA cycle)
rfe00310  Lysine degradation
rfe01100  Metabolic pathways
rfe01110  Biosynthesis of secondary metabolites
rfe01120  Microbial metabolism in diverse environments
rfe01130  Biosynthesis of antibiotics
rfe01200  Carbon metabolism
Module
rfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RF_1093 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RF_1093 (sucB)
Enzymes [BR:rfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RF_1093 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AAY61944
UniProt: Q4UKI7
Position
1162668..1163873
Genome map
AA seq 401 aa AA seqDB search
MSVKIIVPSLGESVTEATIAKWYKKEGDPVKTDELLLEIETEKVTLEVNAPCDGTIGKIS
KTDGANVAVGEEIGEINEGAAANTAGTNNESAKAQAVTQPTSEKPVEKPAVVNNILAPSV
QKLVTENKLDPNNIKGTGRDGRITKGDVLETINTPSAATSTPTVNKTNEERVQRVRMSRL
RKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHLVKLGFMSFFVKATIE
ALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKAIGTLAK
KAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEI
RPMMYIALSYDHRIIDGKEGVSFLVKIKELIENPEKLLLNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccgtcacttggcgagtccgtaacggaagcaactattgcc
aagtggtataagaaagaaggcgatccggttaaaaccgatgagttactgttagaaatcgaa
accgaaaaagtaactttagaagttaatgctccttgcgatggtactataggtaaaatatcg
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggggca
gctgcaaatactgccggtactaataatgaatctgctaaagctcaagcagttacgcagcct
acttcagaaaagcctgtagagaaacctgccgtggttaataatattcttgctccttccgta
caaaaattagttaccgaaaataagcttgatcccaataatataaaaggaacaggtagagac
ggtagaattaccaaaggtgacgtgcttgaaacaataaacacaccgtctgctgctacttct
actcctacagtaaacaaaactaatgaagaaagagtacagcgtgttcgtatgtcacgcttg
cgtaaaactattgcacagcgtttaaaagattcacaaaatacagcagctattttgactact
tttaacgaaatcgatatgtcaaaagtaattgccttgcgtaatcaatataaagaagagttt
gaaaaaaagcacttggtaaaacttggctttatgtcgttttttgttaaagcaacaattgaa
gctttaaagcttattccgtcggtaaatgctgaaatagacggcgatgatttagtatataaa
aattactatgatataggtgtagctgtcggaacagagcaagggcttgttgtaccggttgtt
agggatgccgataaaatgggatttgccgaagtggaaaaagctataggaactttggctaaa
aaggctcgtgaaggtaaactttctatggctgatttgtcaggggggacattctcgatttct
aacggaggcgtatatggctcattattatctacaccgattattaatcctcctcaatcaggt
attctaggcttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaata
cgtccgatgatgtatatagctttatcttacgatcatcgcataattgatgggaaagaagga
gtatcgttcttggtaaaaattaaagagcttattgaaaatccagagaagttactactgaat
ttgtag

DBGET integrated database retrieval system