KEGG   Rickettsia felis: RF_1093Help
Entry
RF_1093           CDS       T00252                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rfe  Rickettsia felis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:rfe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rfe00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rfe00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1162668..1163873
Genome map
AA seq 401 aa AA seqDB search
MSVKIIVPSLGESVTEATIAKWYKKEGDPVKTDELLLEIETEKVTLEVNAPCDGTIGKIS
KTDGANVAVGEEIGEINEGAAANTAGTNNESAKAQAVTQPTSEKPVEKPAVVNNILAPSV
QKLVTENKLDPNNIKGTGRDGRITKGDVLETINTPSAATSTPTVNKTNEERVQRVRMSRL
RKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHLVKLGFMSFFVKATIE
ALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKAIGTLAK
KAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEI
RPMMYIALSYDHRIIDGKEGVSFLVKIKELIENPEKLLLNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccgtcacttggcgagtccgtaacggaagcaactattgcc
aagtggtataagaaagaaggcgatccggttaaaaccgatgagttactgttagaaatcgaa
accgaaaaagtaactttagaagttaatgctccttgcgatggtactataggtaaaatatcg
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggggca
gctgcaaatactgccggtactaataatgaatctgctaaagctcaagcagttacgcagcct
acttcagaaaagcctgtagagaaacctgccgtggttaataatattcttgctccttccgta
caaaaattagttaccgaaaataagcttgatcccaataatataaaaggaacaggtagagac
ggtagaattaccaaaggtgacgtgcttgaaacaataaacacaccgtctgctgctacttct
actcctacagtaaacaaaactaatgaagaaagagtacagcgtgttcgtatgtcacgcttg
cgtaaaactattgcacagcgtttaaaagattcacaaaatacagcagctattttgactact
tttaacgaaatcgatatgtcaaaagtaattgccttgcgtaatcaatataaagaagagttt
gaaaaaaagcacttggtaaaacttggctttatgtcgttttttgttaaagcaacaattgaa
gctttaaagcttattccgtcggtaaatgctgaaatagacggcgatgatttagtatataaa
aattactatgatataggtgtagctgtcggaacagagcaagggcttgttgtaccggttgtt
agggatgccgataaaatgggatttgccgaagtggaaaaagctataggaactttggctaaa
aaggctcgtgaaggtaaactttctatggctgatttgtcaggggggacattctcgatttct
aacggaggcgtatatggctcattattatctacaccgattattaatcctcctcaatcaggt
attctaggcttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaata
cgtccgatgatgtatatagctttatcttacgatcatcgcataattgatgggaaagaagga
gtatcgttcttggtaaaaattaaagagcttattgaaaatccagagaagttactactgaat
ttgtag

DBGET integrated database retrieval system