KEGG   Rickettsia felis: RF_1161Help
Entry
RF_1161           CDS       T00252                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rfe  Rickettsia felis
Pathway
rfe00020  Citrate cycle (TCA cycle)
rfe00190  Oxidative phosphorylation
rfe00650  Butanoate metabolism
rfe01100  Metabolic pathways
rfe01110  Biosynthesis of secondary metabolites
rfe01120  Microbial metabolism in diverse environments
rfe01130  Biosynthesis of antibiotics
rfe01200  Carbon metabolism
Module
rfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rfe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RF_1161 (sdhD)
   00650 Butanoate metabolism
    RF_1161 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RF_1161 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt tRNA_anti_2 CybS PAP2 Fumarate_red_C Fumarate_red_D DUF1240
Motif
Other DBs
NCBI-ProteinID: AAY62012
UniProt: Q4UKC3
Position
complement(1234889..1235251)
Genome map
AA seq 120 aa AA seqDB search
MVYDFKAEIVKAKNSGSHHWLLQRVTGIILALCSIWLIYFTLTNKNNDINIIMWELKKPF
NVVALLITVAISLYHAMLGMRVVIEDYVSCHKLRNTLIVIVQLFCIVTIAAFVVAMFYRG
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctcatcattgg
ttattgcaaagagtaacggggattatattagctttatgttctatatggttaatatatttt
acgctaactaacaaaaataatgacataaatattattatgtgggagcttaaaaagcctttt
aacgtagtagccttgttaattacggtggctatttcgttgtatcatgcaatgcttggtatg
cgtgtagtgattgaggattatgtaagttgtcacaaattacgtaatacattgattgtaata
gtacaattattttgtattgtgactattgcagcttttgtagtagcgatgttttatagggga
tga

DBGET integrated database retrieval system