KEGG   Rickettsia felis: RF_1376Help
Entry
RF_1376           CDS       T00252                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rfe  Rickettsia felis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rfe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rfe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1464033..1465178)
Genome map
AA seq 381 aa AA seqDB search
MYINYLKDLIGFKSVTPESDGAIEYIDDLLKQHGFKTEIKIFGDSKSEQATNLYAVFGSN
EPNICFVGHVDVVPAGNHELWHNASPFKASHQDGKIYGRGAVDMKGAIACFLAASLDFIK
NNTGFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGHKMDFAIVGEPTCEKEIGDTIKIG
RRGSVNFKLNIEGLSGHVAYPHKANNPLPCLIKILNELTNIRLDKGTEFFQSSNLEVTNI
DVGNNTSNVIPASTEASFNIRFNNLHSAETLAKQVEEIIKRYCKEYKVDYKLEYSSSADS
FIQNPNDKIKDFADIVERVLKIKPEFSTSGGTSDARFVKDYCPLVEFGLLSETAHKINEY
TKISDLQKLYDVYYNFLMEIL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacattaactacttaaaagatttgattggttttaagtctgtaactcctgagagtgac
ggggctattgagtatattgatgatttgcttaaacagcacggctttaagaccgaaataaaa
atattcggcgattctaaaagtgagcaagccactaacctttatgctgttttcggtagcaat
gagcctaatatttgctttgttgggcatgtagatgtagtgccggcaggtaatcatgagctt
tggcataatgcgagtccatttaaggctagccaccaagacggtaagatatatggcagaggt
gcggtggatatgaaaggggcgatagcatgctttctagcagctagcttagattttataaaa
aataataccggttttaaaggttctattagtttcttacttactagtgatgaagagggaaaa
gcaaagcatggtactaaagaaatgctgcaatatatttatgaccaagggcataagatggat
tttgctattgtcggtgaacccacttgtgaaaaagaaataggcgacacaattaagatcggc
agaagaggaagtgttaactttaaattaaatatagaaggcttaagcgggcatgtagcttat
cctcataaagcaaataatccgttgccctgcttaataaaaatattgaatgagttaacaaat
ataagacttgataaagggacggaattttttcaaagttcaaatcttgaagtgacgaatatc
gatgtcggtaataatacttcaaacgtaattccggcaagtacggaagcatctttcaatata
cgttttaataatttacatagtgcagaaactttagcaaaacaggtagaagaaattattaaa
cgatattgcaaagaatataaagtagattataaattagaatatagtagttctgctgatagt
tttattcaaaatccaaacgataagataaaagattttgctgatatagtagagagagtgtta
aaaataaagcccgaattttctacaagcgggggtacgtcggatgcaagattcgtcaaagat
tattgtccgttagtagaatttggcttattatccgaaacggcacataaaataaacgaatac
acaaaaattagcgatttacaaaaattatatgatgtgtattataattttttgatggaaata
ctttaa

DBGET integrated database retrieval system