KEGG   Rickettsia felis: RF_1389Help
Entry
RF_1389           CDS       T00252                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rfe  Rickettsia felis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RF_1389
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RF_1389
Enzymes [BR:rfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RF_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1474238..1474630
Genome map
AA seq 130 aa AA seqDB search
MKMKDKVAVITGSTSGIGLEIAKHFAKLESKIVINGFAKETEVAKISAELKELGASNVFY
QGINLAEPEEIFSMFERIIKEFGKIDILVNNAGIQHVAPIDEFPEDKWEQILRIDLIASF
YTTKYAQYRL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgaaagacaaagtagcagttattaccggttctactagcggtatcgggcttgag
atagcaaaacattttgcaaaacttgagtctaaaatagttattaacggttttgcaaaagag
acggaagtagccaaaatttcagcagaattgaaagagcttggtgcaagtaacgtattttat
caaggaataaatttggcagaacctgaagaaatattttctatgtttgagagaataataaaa
gaattcggtaaaatagacatattagtaaataatgccggtattcagcatgttgctcctatc
gatgaatttcctgaagataaatgggagcaaattttgcgtatagatttaatagcttctttc
tatactacaaaatatgcgcaataccgattatga

DBGET integrated database retrieval system