KEGG   Rickettsia felis: RF_1390Help
Entry
RF_1390           CDS       T00252                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rfe  Rickettsia felis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rfe00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rfe00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1474721..1475026
Genome map
AA seq 101 aa AA seqDB search
MVFLGLPKPLLLEVAENNITVNAICPGYVNTPLVQNQIADTAKARHISEESALRDVILKS
QATKKFVEADEIANLVIFLCDKKASSITGSGLLIDGGWTAQ
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggtattcttgggcttaccaaaaccgttgcttttagaagtggctgagaataatattaca
gttaatgctatctgcccaggttacgtcaacacaccgctcgtgcagaatcaaatagcagat
actgctaaagctagacatatcagtgaagaatcggcactccgggatgtaatccttaaatct
caagctactaaaaaatttgtagaagctgatgaaatagcaaacttagtaatattcttatgt
gataaaaaagcatcatcaataacaggtagtgggctcttgatagatggcggctggacggca
cagtag

DBGET integrated database retrieval system