KEGG   Rhodoferax ferrireducens: Rfer_0005Help
Entry
Rfer_0005         CDS       T00334                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rfr  Rhodoferax ferrireducens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6309..7871
Genome map
AA seq 520 aa AA seqDB search
MIAKKPFEIARETLRQLTARKLAPTPINYQAIYNEVAGVATDPPFPTDRLRDIAQALPTK
TPGQQKQRALLDSAIGQLNWDGVKSALMAYGGFSPPAADPATATPSTGLPMPGASAPGDV
SAPALTFDFLQQMARLIEFTLPALGSDDARFNEQTQTLLKAMRQPGADVVALKLMLGSFS
DRLSFAAEDQAEIKVTLLKLLHLIIENIGELSLDDRWLKGQIEALMTASTPPLTLRRLDD
VERRLKDVIFKQTEAKGRALEAQEEMRQMLATFIERLSQMTESTSAYRGKLDDNARLIEQ
ARTLAEIAPVLKEVVGATRTMAHDSLTARDELRGMREKAQSTEAELVKLHQELDRVSSQA
RHDPLTGALNRKGLEEAVNREVSNVRRKETPLCVALLDIDNFKKLNDALGHASGDVALAH
LATVTREVMRPHDTLARYGGEEFVILMPDTALDNGIEAMTRLQRELTTRFFLAGTEKVLI
TFSAGVAQLATDETGQSAIKRADQAMYLAKRAGKNRVLGA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccaagaagccttttgaaattgcccgtgaaacgctcaggcaactcaccgcacgc
aagttggctccaacgccgatcaattaccaggctatttacaacgaggttgcgggggtggcc
accgaccccccttttccgaccgaccgcttgcgcgatatcgcccaggccctgccgacaaaa
acacccgggcagcaaaagcagcgtgctttgttggattccgccatcgggcaactcaactgg
gacggcgtaaagagcgccctcatggcttacggcggcttcagcccaccggcagcggacccg
gccacggccacgccatcgaccgggctgccgatgccgggcgccagcgccccgggcgacgtg
agcgcacccgcgctgacctttgattttttgcagcaaatggcacggttgattgagttcaca
ctgcccgcactcggttccgatgatgcccgcttcaacgagcagacccagaccctgctcaaa
gccatgcgccaacctggggctgacgtggtggcgctcaaattgatgctgggcagctttagc
gaccgtctttcctttgccgcggaagatcaggccgagatcaaggtcacgctactcaagctg
ctgcacctgatcatcgaaaacatcggtgagctcagtctggatgatcgttggctcaagggc
cagattgaggccctgatgacggcgtcgacgcctccgctcaccttgcgccgtctcgacgac
gtggagcggcgcctgaaggacgtgatcttcaaacagaccgaggccaagggtcgggccctg
gaggcgcaggaagagatgcgccagatgctcgccaccttcatcgagcggctgtcgcaaatg
accgagtccaccagcgcctaccgcggcaagctcgatgacaacgcacgcctgatcgagcaa
gccaggaccctggctgaaattgcgccggtcttgaaagaagtggtcggcgcgacccgcacc
atggcccacgacagcctgacggcacgtgatgaactgcgtggcatgcgcgaaaaggcgcaa
agcaccgaggccgagctcgtcaagctgcaccaggagcttgaccgcgtcagctcccaggcg
cggcatgacccgctgaccggggcacttaatcgcaaggggctggaggaggccgtcaaccgg
gaggtgtccaatgtgcgacgcaaagagacgccgctgtgtgtggccctgctggacattgac
aacttcaagaagctcaatgacgccctgggtcacgcgagcggggatgtcgcgttggcgcat
ctggccacggtaacgcgtgaggtcatgcgcccgcatgacacgctggcgcgctacggcggt
gaagagttcgtgattctgatgcccgacaccgccctggataatggcattgaagccatgacc
cggttgcagcgcgagctgaccacacgtttctttctggcaggcaccgagaaggtgctgatt
accttcagcgccggtgtggcgcaactggccactgacgagaccggtcagagcgccatcaag
cgcgccgaccaggccatgtacctggccaaacgcgcgggcaagaatcgcgtgttgggcgct
taa

DBGET integrated database retrieval system