KEGG   Rhodoferax ferrireducens: Rfer_0362Help
Entry
Rfer_0362         CDS       T00334                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rfer_0362
   01230 Biosynthesis of amino acids
    Rfer_0362
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_0362
   00030 Pentose phosphate pathway
    Rfer_0362
   00051 Fructose and mannose metabolism
    Rfer_0362
   00052 Galactose metabolism
    Rfer_0362
  Energy metabolism
   00680 Methane metabolism
    Rfer_0362
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Rfer_0362
Enzymes [BR:rfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rfer_0362
Protein phosphatases and associated proteins [BR:rfr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rfer_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(363177..364391)
Genome map
AA seq 404 aa AA seqDB search
MASGKILVAQGGGPTAVINQSLVGVALEARRFSQVAHIYGARHGVRGIVDEEFVDLTQET
SHNLELVANTPSSALGSTRDKPDIAYCQEIFRVLQAHQIEHFFYIGGNDSSDTVRIVSQE
AQKAGYPLRSIHIPKTIDNDLVGNDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGKKFPDDGPHLIYLPERTFVLEQFLLDVKTTYERYGRCVIAVSEGIH
DAQGTPIAALLAKEMEHDAHGNVQLSGNGALADLLCDEIKARLKIKRVRGDTFGYLQRSF
IGCVSDVDQREAREVGEKAVQFAMWGGHDGSVAIKRTGFYSVDYELLPLDAVAGKTRVME
DEFIAASGTDVTDAFRMYLRPLLGSGMPDAFRLRHNPVAKVLHR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggaaaaatactcgtcgcccaaggtggcggccccacggcagtgatcaatcag
tcgctggtcggcgtggcgctggaggcgcgccgctttagccaggtggcgcacatctatggc
gcgcgccatggcgtgcgcggcatcgttgatgaagagtttgtggatctcacccaggagacc
agccacaacctggaactggtagccaacacgccctcaagcgccctgggttcgacccgcgac
aagcctgatatcgcctattgccaggagattttcagggtgttgcaggcgcatcagatcgaa
cacttcttctacatcggcggcaacgactccagcgacacggtgcgtatcgtcagccaggaa
gcacaaaaagccggctaccccttgcgcagcattcacatccccaagaccatcgacaacgac
ctggtgggcaacgaccacacaccgggcttcccctcggcggcgcgctttgtggcgcaagcc
tttgccggggccaacctggacaatgcggcactgcccggcgtctacgtaggggtggtgatg
gggcgccatgccggttttttgaccgcggcgtccgccttgggcaagaagttcccggatgac
gggccgcacttgatctacctgcccgagcgcacctttgtgctggaacaatttctgctcgat
gtcaagaccacctacgagcgctatggtcgctgcgtcatcgccgtgtccgaaggcattcat
gacgcccaaggcacgccgattgccgcgctgttggccaaggaaatggagcacgacgcgcac
ggcaatgtgcagctctcgggcaacggcgcgctggccgacttgctgtgtgacgagatcaag
gccagactcaagatcaaacgcgtgcgtggcgacacctttggctacctgcagcgatcgttc
atcggctgcgtgtccgatgtcgatcaacgcgaagcccgtgaggtcggcgagaaagccgtg
cagtttgcgatgtggggcgggcacgacggctcggtggcgatcaagcgcaccggtttttac
tcggtcgactatgagctgctgccccttgacgcggtggctggcaagacacgggtgatggaa
gacgaatttatcgccgccagcggcaccgatgtgaccgatgcgtttcgcatgtacctgcgc
ccgttgctggggtccggcatgcccgacgccttccggctgcgccacaatcccgtggccaag
gtacttcatagataa

DBGET integrated database retrieval system