KEGG   Rhodoferax ferrireducens: Rfer_0362Help
Entry
Rfer_0362         CDS       T00334                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00010  Glycolysis / Gluconeogenesis
rfr00030  Pentose phosphate pathway
rfr00051  Fructose and mannose metabolism
rfr00052  Galactose metabolism
rfr00680  Methane metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_0362
   00030 Pentose phosphate pathway
    Rfer_0362
   00051 Fructose and mannose metabolism
    Rfer_0362
   00052 Galactose metabolism
    Rfer_0362
  Energy metabolism
   00680 Methane metabolism
    Rfer_0362
Enzymes [BR:rfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rfer_0362
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Rfer_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABD68116
JGI: Rfer0362
UniProt: Q222D7
Position
complement(363177..364391)
Genome map
AA seq 404 aa AA seqDB search
MASGKILVAQGGGPTAVINQSLVGVALEARRFSQVAHIYGARHGVRGIVDEEFVDLTQET
SHNLELVANTPSSALGSTRDKPDIAYCQEIFRVLQAHQIEHFFYIGGNDSSDTVRIVSQE
AQKAGYPLRSIHIPKTIDNDLVGNDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGKKFPDDGPHLIYLPERTFVLEQFLLDVKTTYERYGRCVIAVSEGIH
DAQGTPIAALLAKEMEHDAHGNVQLSGNGALADLLCDEIKARLKIKRVRGDTFGYLQRSF
IGCVSDVDQREAREVGEKAVQFAMWGGHDGSVAIKRTGFYSVDYELLPLDAVAGKTRVME
DEFIAASGTDVTDAFRMYLRPLLGSGMPDAFRLRHNPVAKVLHR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggaaaaatactcgtcgcccaaggtggcggccccacggcagtgatcaatcag
tcgctggtcggcgtggcgctggaggcgcgccgctttagccaggtggcgcacatctatggc
gcgcgccatggcgtgcgcggcatcgttgatgaagagtttgtggatctcacccaggagacc
agccacaacctggaactggtagccaacacgccctcaagcgccctgggttcgacccgcgac
aagcctgatatcgcctattgccaggagattttcagggtgttgcaggcgcatcagatcgaa
cacttcttctacatcggcggcaacgactccagcgacacggtgcgtatcgtcagccaggaa
gcacaaaaagccggctaccccttgcgcagcattcacatccccaagaccatcgacaacgac
ctggtgggcaacgaccacacaccgggcttcccctcggcggcgcgctttgtggcgcaagcc
tttgccggggccaacctggacaatgcggcactgcccggcgtctacgtaggggtggtgatg
gggcgccatgccggttttttgaccgcggcgtccgccttgggcaagaagttcccggatgac
gggccgcacttgatctacctgcccgagcgcacctttgtgctggaacaatttctgctcgat
gtcaagaccacctacgagcgctatggtcgctgcgtcatcgccgtgtccgaaggcattcat
gacgcccaaggcacgccgattgccgcgctgttggccaaggaaatggagcacgacgcgcac
ggcaatgtgcagctctcgggcaacggcgcgctggccgacttgctgtgtgacgagatcaag
gccagactcaagatcaaacgcgtgcgtggcgacacctttggctacctgcagcgatcgttc
atcggctgcgtgtccgatgtcgatcaacgcgaagcccgtgaggtcggcgagaaagccgtg
cagtttgcgatgtggggcgggcacgacggctcggtggcgatcaagcgcaccggtttttac
tcggtcgactatgagctgctgccccttgacgcggtggctggcaagacacgggtgatggaa
gacgaatttatcgccgccagcggcaccgatgtgaccgatgcgtttcgcatgtacctgcgc
ccgttgctggggtccggcatgcccgacgccttccggctgcgccacaatcccgtggccaag
gtacttcatagataa

DBGET integrated database retrieval system