KEGG   Rhodoferax ferrireducens: Rfer_0388Help
Entry
Rfer_0388         CDS       T00334                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00010  Glycolysis / Gluconeogenesis
rfr00620  Pyruvate metabolism
rfr00640  Propanoate metabolism
rfr00680  Methane metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_0388
   00620 Pyruvate metabolism
    Rfer_0388
   00640 Propanoate metabolism
    Rfer_0388
  Energy metabolism
   00680 Methane metabolism
    Rfer_0388
Enzymes [BR:rfr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rfer_0388
Lipid biosynthesis proteins [BR:rfr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rfer_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABD68142
JGI: Rfer0388
UniProt: Q222B1
Position
complement(395956..397764)
Genome map
AA seq 602 aa AA seqDB search
MLSQGRRMERPVVIHKVASDLRLSPNWVDYEAGRRVDVWADARHALQGLPGGGLNLGFEA
VDRQAAGALRDHVALRFVARNAPPLDLRYFELAQQTNRFANVLRSLGVGKGDHLFVLAGR
IPELYVAVLGALKNGSVVTPLFSAFGPEPIAARIQLGAGRVLVTTDALYQRKVKQIRAQT
PTLVHVLLVAEDGGITNEPDTLDLGTLMASASDTFSTVETQPDDPALLHFTSGTTGTPKG
ALHVHEAVVTHFATGRYALDLHPQDRYWCTADPGWVTGTSYGIIAPLLQGVTSLIDREEF
DAERWYTLLEQERISVWYTAPTAIRMLMKAGTELAQRHSHPDLRFIASVGEPLNPEAVWW
GQEALGLPIHDNWWQTETGGIMIANTPAFDIKPGSMGRPLPGIDACIVEHLEAEGEPARV
RVIEEANVEGELALKRGWPSMFRAYLNNEARYRKCFAGELYLTGDLAKRDADGYYWFVGR
ADDVIKSAGHLIGPFEVESVLMEHPAVAEAGVIGKPDPVVGEVVKAFVSLKDGYQAGETL
RLDISAHARRRLGAAVAPKEIVFLPTLPRTRSGKIMRRLLKARELGLPEGDTSTLEGGAW
TK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtcaaggcaggcgcatggaaagacccgtcgtcattcacaaggttgcatcggac
ttgcgcctgtcacccaattgggtggattacgaggctggacggcgcgttgacgtgtgggct
gatgcccggcacgccttgcagggcctgcccggcggtggcctgaaccttggcttcgaggcc
gtggaccgccaggccgcgggcgccctgcgcgatcacgtcgcactgcgttttgtcgcgcgc
aacgcacctccactggacttgcgctactttgagttggcccagcaaacgaatcgctttgcc
aacgtcttgcgcagtctgggcgtgggcaagggcgatcacctgtttgtgctggccggacgt
attcccgaactgtacgttgcggtgctgggcgcgctgaagaatggcagcgtggtgaccccg
ctgttttccgcctttggcccggagccaatcgccgcccgcatccagcttggcgcgggccgg
gtgctggtgaccaccgacgcactctaccaacgcaaggtgaagcaaattcgggcgcaaacg
cccacccttgtgcacgtgctgctggtggccgaggacggtggcatcaccaatgagccggac
acactggatcttggcacgctgatggcgtcggcttctgacaccttcagcaccgtcgagacg
cagccggacgaccctgccctgttgcatttcaccagtggcaccaccggcacacccaaaggc
gcgctgcatgtgcacgaggccgtggtgacccactttgccaccggtcgctacgcgcttgat
ttacacccgcaggatcgctactggtgcacggctgatcccggctgggtcaccggcacctcc
tacggcatcatcgcgcccctgctgcagggcgtcacctcgctgattgatcgcgaggaattt
gatgccgagcgctggtacacgctgctggaacaggagcgcatcagcgtctggtacaccgcg
ccgaccgcgattcgcatgttgatgaaagccggcaccgagctggcgcagcgccacagccat
ccagacctgcgctttatcgccagcgtcggtgaaccgctgaacccggaggcggtctggtgg
ggccaggaggcgctgggcttgccgattcacgacaactggtggcagaccgagaccggcggc
atcatgatcgccaacaccccggccttcgacatcaaacccggctccatgggccgccccttg
cccggcattgacgcctgcatcgtcgagcacctggaagccgagggtgagccggcgcgggtg
cgcgtcattgaggaggccaatgtcgaaggcgaactcgcgctgaaacgcggctggccgtcc
atgtttcgtgcctacctcaacaacgaggcccgttaccgcaagtgtttcgccggtgagctg
tacctgaccggcgatctggccaagcgcgatgccgatggctattactggttcgtcggccgt
gccgatgacgtcatcaagtcagccgggcacctgatcgggccgttcgaggtcgagagcgtg
ctgatggagcacccggcggtggccgaggccggcgtcatcggcaagcccgatccggtggtc
ggtgaggtggtcaaggcgtttgtctcgctcaaggacggctaccaggccggcgagaccttg
cgcctggacatctcggcccacgcgcgccgacggctcggtgccgccgtggcacccaaggag
atcgtctttttgcccacgctgccgcgcacgcgcagcggcaagatcatgcgccgcctgctc
aaggcgcgtgaactcgggctgcccgagggcgacacctcgaccctggagggtggcgcatgg
acaaaatga

DBGET integrated database retrieval system