KEGG   Rhodoferax ferrireducens: Rfer_0388Help
Entry
Rfer_0388         CDS       T00334                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rfer_0388
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_0388
   00620 Pyruvate metabolism
    Rfer_0388
   00640 Propanoate metabolism
    Rfer_0388
  Energy metabolism
   00680 Methane metabolism
    Rfer_0388
Enzymes [BR:rfr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rfer_0388
Lipid biosynthesis proteins [BR:rfr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rfer_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(395956..397764)
Genome map
AA seq 602 aa AA seqDB search
MLSQGRRMERPVVIHKVASDLRLSPNWVDYEAGRRVDVWADARHALQGLPGGGLNLGFEA
VDRQAAGALRDHVALRFVARNAPPLDLRYFELAQQTNRFANVLRSLGVGKGDHLFVLAGR
IPELYVAVLGALKNGSVVTPLFSAFGPEPIAARIQLGAGRVLVTTDALYQRKVKQIRAQT
PTLVHVLLVAEDGGITNEPDTLDLGTLMASASDTFSTVETQPDDPALLHFTSGTTGTPKG
ALHVHEAVVTHFATGRYALDLHPQDRYWCTADPGWVTGTSYGIIAPLLQGVTSLIDREEF
DAERWYTLLEQERISVWYTAPTAIRMLMKAGTELAQRHSHPDLRFIASVGEPLNPEAVWW
GQEALGLPIHDNWWQTETGGIMIANTPAFDIKPGSMGRPLPGIDACIVEHLEAEGEPARV
RVIEEANVEGELALKRGWPSMFRAYLNNEARYRKCFAGELYLTGDLAKRDADGYYWFVGR
ADDVIKSAGHLIGPFEVESVLMEHPAVAEAGVIGKPDPVVGEVVKAFVSLKDGYQAGETL
RLDISAHARRRLGAAVAPKEIVFLPTLPRTRSGKIMRRLLKARELGLPEGDTSTLEGGAW
TK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtcaaggcaggcgcatggaaagacccgtcgtcattcacaaggttgcatcggac
ttgcgcctgtcacccaattgggtggattacgaggctggacggcgcgttgacgtgtgggct
gatgcccggcacgccttgcagggcctgcccggcggtggcctgaaccttggcttcgaggcc
gtggaccgccaggccgcgggcgccctgcgcgatcacgtcgcactgcgttttgtcgcgcgc
aacgcacctccactggacttgcgctactttgagttggcccagcaaacgaatcgctttgcc
aacgtcttgcgcagtctgggcgtgggcaagggcgatcacctgtttgtgctggccggacgt
attcccgaactgtacgttgcggtgctgggcgcgctgaagaatggcagcgtggtgaccccg
ctgttttccgcctttggcccggagccaatcgccgcccgcatccagcttggcgcgggccgg
gtgctggtgaccaccgacgcactctaccaacgcaaggtgaagcaaattcgggcgcaaacg
cccacccttgtgcacgtgctgctggtggccgaggacggtggcatcaccaatgagccggac
acactggatcttggcacgctgatggcgtcggcttctgacaccttcagcaccgtcgagacg
cagccggacgaccctgccctgttgcatttcaccagtggcaccaccggcacacccaaaggc
gcgctgcatgtgcacgaggccgtggtgacccactttgccaccggtcgctacgcgcttgat
ttacacccgcaggatcgctactggtgcacggctgatcccggctgggtcaccggcacctcc
tacggcatcatcgcgcccctgctgcagggcgtcacctcgctgattgatcgcgaggaattt
gatgccgagcgctggtacacgctgctggaacaggagcgcatcagcgtctggtacaccgcg
ccgaccgcgattcgcatgttgatgaaagccggcaccgagctggcgcagcgccacagccat
ccagacctgcgctttatcgccagcgtcggtgaaccgctgaacccggaggcggtctggtgg
ggccaggaggcgctgggcttgccgattcacgacaactggtggcagaccgagaccggcggc
atcatgatcgccaacaccccggccttcgacatcaaacccggctccatgggccgccccttg
cccggcattgacgcctgcatcgtcgagcacctggaagccgagggtgagccggcgcgggtg
cgcgtcattgaggaggccaatgtcgaaggcgaactcgcgctgaaacgcggctggccgtcc
atgtttcgtgcctacctcaacaacgaggcccgttaccgcaagtgtttcgccggtgagctg
tacctgaccggcgatctggccaagcgcgatgccgatggctattactggttcgtcggccgt
gccgatgacgtcatcaagtcagccgggcacctgatcgggccgttcgaggtcgagagcgtg
ctgatggagcacccggcggtggccgaggccggcgtcatcggcaagcccgatccggtggtc
ggtgaggtggtcaaggcgtttgtctcgctcaaggacggctaccaggccggcgagaccttg
cgcctggacatctcggcccacgcgcgccgacggctcggtgccgccgtggcacccaaggag
atcgtctttttgcccacgctgccgcgcacgcgcagcggcaagatcatgcgccgcctgctc
aaggcgcgtgaactcgggctgcccgagggcgacacctcgaccctggagggtggcgcatgg
acaaaatga

DBGET integrated database retrieval system