KEGG   Rhodoferax ferrireducens: Rfer_0571Help
Entry
Rfer_0571         CDS       T00334                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rfr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rfr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
592458..593579
Genome map
AA seq 373 aa AA seqDB search
MARWICFEDIELKKIRVVVVDDSALVRSLLAEIINRQKDMECVGTANDPLIAREMIRELN
PDVLTLDIEMPRMDGIDFLGRLMRLRPMPVVMVSTLTERGAEITMKALELGAIDFVAKPR
IGVASGLTELSDQIVEKVRIAATAHVRRAPAVPAAATPAVGGAVGGHAPVASIGRVSTEK
LICIGASTGGTEAIKEILTRLPADSPGIVITQHMPPGFTTSFAARLNSLCQIAVQEAVNG
ERILPGHAYIAPGGKQFRVSRSGANYVALVEDGELVNRHKPSVEVLFKSVASVVGRNAYG
VMLTGMGNDGAKAMREMKDAGSYNFVQDEASCIVFGMPREAILHGAADEVLPLTAIAPAL
IAKLSSATDRYRV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtggctcggtggatttgttttgaggatattgaattgaaaaaaattcgcgtggtggtggtc
gatgattctgccttggtgcgcagtctgttggcggaaatcatcaatcggcaaaaggacatg
gaatgtgtgggaactgccaatgaccccctgatcgcacgggaaatgatccgtgaactcaat
cctgacgtcctgacccttgatattgagatgccacggatggatggcatcgattttttgggt
cggctcatgcgtttgcggccgatgccggtggtgatggtctcgaccctgaccgagcgtggt
gccgaaattacgatgaaggcgctggaacttggtgccattgattttgtggccaagcccaga
attggtgtcgctagcggcctgaccgagttgtcggaccaaatcgtggagaaggttcgcatc
gccgcgacggcacatgttagacgcgccccggctgtgcctgctgctgccaccccggccgtg
gggggggcagtgggtggtcacgccccggtggcgtctatcggccgcgtgtcgaccgagaag
ctgatatgtattggcgcctcgaccggtggtaccgaggccatcaaggaaatactgacgcgt
cttcccgccgactcacctggcatcgtgatcacccagcacatgccaccgggctttaccacc
agctttgccgcgcgactgaacagcttgtgccagattgcagtgcaagaggcggtcaacggt
gagcgcatcctgccgggacacgcctatatcgcaccgggcggcaaacaattccgggtcagc
cgcagtggtgccaattatgtggcgctggtggaagatggcgagttggttaatcggcacaaa
ccgtcggttgaagtgctgtttaaatcggtcgccagcgtggtgggtcgcaatgcgtatggt
gtcatgttgaccggcatgggcaacgatggcgccaaggcgatgcgcgaaatgaaggatgcc
ggcagctacaactttgtgcaggatgaggcgtcctgcatcgtctttgggatgccgcgtgaa
gcgattttgcatggtgccgccgacgaagtgttgccgctgacggccatcgcgcccgcgctg
atcgccaagctgagcagcgccacagaccgttaccgggtgtga

DBGET integrated database retrieval system