KEGG   Rhodoferax ferrireducens: Rfer_0597Help
Entry
Rfer_0597         CDS       T00334                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rfer_0597
Enzymes [BR:rfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Rfer_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
622914..623861
Genome map
AA seq 315 aa AA seqDB search
MAPKNQPLSGNAMPRFGGIASMLRLPVSSSPEGLDAAFIGVPLDIGTSHRPGARFGPRQI
RAESALIRPYNMATGAAPFDTLQVADLGDVPINTYSLTKSLPIITNFYRTVLEAGCTPLT
LGGDHTIALPILRAMAAKHGPVALVHVDAHADVNEEMFGEPVAHGTPFRRAVEEGLLDCH
KVFQIGLRGSGYASDDFDWPRQQGFTLVMAHEVWYQSLAPLMANIRAHIGQTPCYLSFDI
DGIDPAYAGGTGTPEIGGLTVPQALEIVRGCSGLNLIGCDLVEVSPAYDVSGNTALLGAN
LLFEMLCVLPGVLRR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaaaaatcaacccttgtccggcaacgccatgccgcgtttcggcggcatcgcc
agcatgttgcgcctgcctgtttccagctcccccgagggcctcgatgcagcctttattggc
gtgccgctggacatcggcacctcgcaccggcccggtgcgcgttttggcccgcgccagatt
cgcgccgagtcagcactgatccggccctacaacatggcgaccggcgcggcgccgtttgac
acgctgcaagtagcggatctgggcgatgtgccgatcaacacctattcgctgacaaaatcg
ctgccgatcatcaccaatttttaccggacggtgctggaggccggttgcacacccctgacc
ttgggtggtgaccacaccattgccctgcccatcctgcgcgccatggcggccaaacatggc
ccggtcgcgctggtgcatgtggatgcccatgccgatgtcaacgaagagatgtttggcgag
ccggtggcacacggcacaccgtttcgccgggcggttgaagaaggtttgctggactgccac
aaggtgtttcagattggcctgcgcggcagcggctacgcgtccgacgactttgactggccc
cggcagcagggctttacgctggtgatggcccacgaggtctggtaccagtcactcgcgccc
ctgatggccaatatccgggcccacattggccagaccccgtgttacctgagctttgacatc
gacggtatcgatccggcgtatgccggcggcacgggcacgccggagataggtggtttgact
gtgccgcaggcccttgagatcgttcgtggctgctcgggtctcaacctgatcggctgcgac
ctggttgaagtctcgcctgcgtatgatgtgagcggcaacaccgccctgctcggggccaac
ctgttgttcgagatgctgtgcgtgctgccaggcgtcctcagacgctag

DBGET integrated database retrieval system