KEGG   Rhodoferax ferrireducens: Rfer_0828Help
Entry
Rfer_0828         CDS       T00334                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rfer_0828
Enzymes [BR:rfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Rfer_0828
    3.5.1.-  
     Rfer_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(864844..865452)
Genome map
AA seq 202 aa AA seqDB search
MSSHTHPISLQTGDALLIVDVQSDFLPGGSLAVPRGDEVIAVLNGYLAAFQQARLPVLAT
RDWHPSKHCSFLPQGGPWPPHCVAGSTGANLAPGLKLPADVIVISKATDRSRDAYSGFEG
TELDRLLREAGVRRLFIGGLATDYCVLNTVGDALKLGYQTVLLQDAVRAVDVHPGDGARA
MGQMLERGAMAVTLKQIRVVSP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtcatacgcaccccatttcactgcaaaccggcgatgcactgctgatcgttgac
gttcaatcagatttcctccccggcggcagtctggcggtgccccggggtgatgaggtgatc
gctgtgctcaatggctatctggccgcattccagcaggccaggctaccagtgctggccacg
cgcgactggcacccgagcaagcattgctccttcctgccgcaaggcgggccgtggccgccg
cattgcgtggcaggcagcacgggggccaaccttgcgccggggctcaagctgccggctgat
gtcatcgtgatttccaaggccacagaccgcagccgtgatgcctattcaggattcgaaggc
accgaactcgaccgtttattgcgcgaagccggggtcaggcgtctcttcattggcggtctg
gcgactgactattgcgtgctcaatacggtgggtgacgccttgaaactgggctatcaaacg
gtcttgctgcaagacgcggtccgcgcggtggatgtgcatccgggtgacggcgcgcgtgct
atgggccaaatgctggaaagaggcgccatggccgtgaccttgaaacaaatcagggtggta
tcaccatga

DBGET integrated database retrieval system