KEGG   Rhodoferax ferrireducens: Rfer_1106Help
Entry
Rfer_1106         CDS       T00334                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Rfer_1106
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Rfer_1106
Enzymes [BR:rfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Rfer_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1185479..1186945)
Genome map
AA seq 488 aa AA seqDB search
MQTCMQRAGSPVVVAVLVLTWGVAVQAQSTAASGGKFRGDAVQTWVTLTDQSKLLAPQEG
VIFSGKLPLPLNIDVDVGKRYQEIVGFGANISDASAWLIQNRMNAQQRQALMADLFGKPP
GIGLSFTRLTIGAADFSRSHYTLDDVAAGQTDYPLAKFSIAPLRADVLPVVKSALAINPK
LRVMASPWSAPAWMKSNDSLIQGTLRPQAYGAFSQYLEKFADAMEAEGVPLYALTVQNEP
HFEPKDYPGMRLESAVRAKLIGEHLGPLLAKRDKPVRILDWDHNWDEPQAPLQVLADPQA
RPYVAGVAWHCYAGDVAVQSMVHDAHPDKETYLTECSGGEWKPHWGETLPWYMRNLIIGT
TRGWAKGVLLWNIALDENHGPHNGGCSDCRGVVTINSKTGEVTRNLDYYALAHASRFVRP
GAHRIESTTGVDQLETVAFQNADDNSIALIVLNSASNSRRFSVRLGDHTFEHTMPGASVA
TFVWQAPH
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacatgtatgcaacgagcaggatcacctgtggtggttgccgttttggtgctgacc
tggggcgtggcggtacaggcgcagtccacggcggcatcaggtggcaagttccggggcgat
gccgtgcagacttgggtgactctgacggaccagtcgaagctgctcgctccacaggagggt
gtgatctttagcggcaagctgccactgccgttgaatatcgacgttgacgtcggcaagcgc
taccaggagatcgtcggctttggcgccaacatttcagatgcgtcggcctggttgatccag
aaccggatgaacgcgcagcagcgacaggcgctgatggcagatttgttcggcaagccgccc
ggcatcggtttgagcttcacacgcctgactatcggtgctgctgacttttcgcgcagccac
tacacactcgatgatgtagcggccgggcaaaccgactaccctctggcaaagttttccata
gcccccctgcgcgccgatgtgctgccggtggtcaaaagcgcccttgccatcaatcccaag
ttgcgcgtcatggcatcaccctggagcgcaccggcctggatgaagagcaatgacagcctg
atccagggcacgttgcgcccgcaggcctacggtgcattttctcagtaccttgaaaaattt
gccgatgcgatggaagccgagggcgtgcccctgtatgcgctgaccgtgcagaacgaaccc
cacttcgagcccaaggactatccggggatgagactggagtctgcagtccgtgccaagctg
atcggcgagcacctggggcccctgctggccaagcgtgacaagccggtgcgtattctggat
tgggaccataactgggatgagccccaggcgcccctgcaggtgctggccgacccgcaagcg
cgtccttatgtggcgggcgtcgcatggcactgctatgccggcgatgtggcggtgcagtcg
atggtgcacgatgcccatccggacaaggaaacctacctcaccgaatgttctggtggcgag
tggaaaccacactggggggagaccctcccgtggtacatgcggaacctgatcatcggtacc
acacggggctgggccaagggcgtattgctgtggaacattgcgctggacgaaaaccatggc
ccccacaatggcggctgtagcgattgtcgtggcgtggtgaccatcaactccaagacgggt
gaggtgacgcgtaatttggactactacgcgctggcgcacgccagccgctttgtacgaccg
ggcgcgcaccgcattgaatctacgaccggggtggatcagctggagacggtggccttccag
aatgcagatgacaactcgatcgccctgattgtgttgaattcggcaagcaattcgcgtcgt
ttctcggtgcgtcttggtgatcacactttcgagcacacgatgccaggcgccagcgttgct
acctttgtctggcaggcgccgcactga

DBGET integrated database retrieval system