KEGG   Rhodoferax ferrireducens: Rfer_1252Help
Entry
Rfer_1252         CDS       T00334                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rfer_1252
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rfer_1252
Enzymes [BR:rfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rfer_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1346020..1346445
Genome map
AA seq 141 aa AA seqDB search
MIDGVLLTPLKRVYHPSGDILHAMKASSPGFHGFGEAYFSLIKKDFIKGWKRHNRLTLNL
IVPVGSIRFVICDDRYKENNTPEFLDVIIDKDNYVRLTIPPGVWVCFKGLEETNLLMNII
AEEHDMAESDNIPLEAINFSF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgattgatggagttttattgacgccgttaaagcgcgtttaccaccccagtggtgacatt
cttcacgccatgaaagccagctcgcccggctttcatggttttggcgaggcgtatttttct
ttaataaaaaaagactttatcaagggttggaagcgtcacaatcggctgactttaaatctg
attgtgccggtagggtcgatacgatttgtaatttgtgatgaccgttataaagaaaataat
acgcctgagtttctcgatgtaattattgataaagataactatgtgcgtctgacaattcca
ccaggagtttgggtttgttttaaaggtttggaagaaacgaacctactgatgaatattatc
gctgaagagcacgacatggcggagtcggataatattccgcttgaggctataaacttttct
ttttaa

DBGET integrated database retrieval system