KEGG   Rhodoferax ferrireducens: Rfer_1271Help
Entry
Rfer_1271         CDS       T00334                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rfer_1271
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rfer_1271
Enzymes [BR:rfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rfer_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1364185..1365321
Genome map
AA seq 378 aa AA seqDB search
MTKNFASVVLRDARRIVVKVGSSLVTNEGRGLDETAIGEWCRQIALLVQDKREVIMVSSG
AVAEGMKRLGWATRPHLIHELQAAAAVGQMGLAQMYETKLRENGLGSAQVLLTHADLADR
ERYLNARSTLLTLLKLGVVPVINENDTVVNDEIKFGDNDTLGALVANLVEADALVILTDQ
KGLFTADPRKDSSATLVHEAKSGDPALEAMAGGAGSNLGRGGMITKILAAKRAAGSGAST
VIAWGREPDALVRLSQGDAIGTLLVAQTQKTQARKQWIADHLQLRGSVTVDAGATQKLRG
QGSSLLPIGMTTVDGDFSRGDVIAIRDLQGVEIARGLANYASVEARLICRKPSTEFEKLL
GYAAEPEMVHRDNLVLTR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaattttgcatcggtggtgttgcgtgatgcccggcgcatcgtggtcaaggtg
ggctccagcctcgtcaccaacgaggggcgtggactggatgaaaccgcgattggcgaatgg
tgtcgccagatcgccctgctggtgcaggacaagcgtgaagtgatcatggtctccagcggc
gccgtggccgagggcatgaagcgcctgggctgggccacgcggccgcatctcattcatgag
ctgcaggccgccgccgccgtcggtcagatgggactggcgcagatgtacgagaccaagctg
cgtgaaaacggtttgggcagcgcgcaggtgctgctcacgcacgccgacctggccgaccgg
gagcgttacctgaacgcgcgttccaccttgctgactctgctcaaactgggcgtggtgccg
gtgatcaacgagaacgacacggtggtcaacgacgaaatcaagtttggtgacaacgacacg
ctgggcgccctggtggccaacctggtggaggccgatgccctggtcattttgaccgaccaa
aaagggctttttacggcggatccgcgcaaggattcttctgccacgttggtgcatgaggcc
aagtcgggcgacccggcactggaggcgatggccggcggcgcgggctccaacctggggcgc
ggcggcatgatcaccaaaatactggcggccaagcgcgcggctggctcgggcgcctcgacc
gtgattgcctggggccgcgagcccgatgcgctggtgcgcctgagccagggcgacgccatc
gggacgctgctggtggcgcagacacagaaaacacaggcccgcaaacagtggattgccgac
cacttgcagctgcgcggctcggtgacggtggacgccggcgcgacgcaaaaattgcgtggt
cagggcagcagcctgctgccgattggcatgacaaccgtggatggcgatttctcacgcggt
gatgtgattgccatccgggatttgcagggcgtcgaaatagcgcgcggcctggccaactac
gccagcgtggaggcaaggcttatttgtcgcaagccctccactgaatttgaaaagctgctg
ggctatgccgccgagccggagatggtgcaccgggataatctggtgctgacccgttag

DBGET integrated database retrieval system