KEGG   Rhodoferax ferrireducens: Rfer_1301Help
Entry
Rfer_1301         CDS       T00334                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rfer_1301
Enzymes [BR:rfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rfer_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1395547..1396275
Genome map
AA seq 242 aa AA seqDB search
MLMKSQSTMNPSDADEGIPVSVKIRQRLLAARKRFHANDNIADFIEPGELEQLLDEVEDK
MKGVLSSLVIDTDHDHNTDETARRVAKMYLKEVFNGRYVSAPTITEFPNAEHLNELMIVG
PITVRSACSHHLCPIVGQIWIGVLPNEHTNVIGLSKYARLAEWVMGRPQIQEEAVVQLAD
LIQEKTQPDGLAIVMEATHFCMGWRGVKDLDSKMINSVMRGSFLKDPNLRREFLSLIPKK
EG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgaaaagccaaagcaccatgaatccaagcgatgccgatgagggtattcccgtc
tccgtcaaaattcggcaacgcctgctggcggcgcgcaagcgcttccacgccaacgacaac
attgccgatttcatcgagcccggtgagcttgagcagttgctcgacgaggtggaagacaag
atgaaaggcgtcctgagcagcctggtgattgacaccgaccatgatcacaacaccgacgag
acggcgcgccgggtcgccaagatgtatctcaaagaggtgttcaacggccgctacgtcagc
gcgcccaccatcaccgagtttcccaatgccgagcatctcaatgagttgatgatcgtgggc
ccgatcacggtgcgcagtgcctgcagccatcacttgtgtccgatcgtcggccagatctgg
attggtgtgttgccgaatgaacataccaatgtgattggcctgtccaagtacgcgcgactg
gccgagtgggtgatgggccgaccgcagattcaggaggaagcggtggtccagctggccgat
ctgattcaggaaaagacccagcccgacggcctggccatcgtgatggaggcgacccatttc
tgcatgggctggcgcggcgtcaaggacctggacagcaagatgatcaattcggtcatgcgg
ggcagcttcctcaaggaccccaatctgcgccgtgaattcctgtcccttattcccaagaaa
gaaggctga

DBGET integrated database retrieval system