KEGG   Rhodoferax ferrireducens: Rfer_1309Help
Entry
Rfer_1309         CDS       T00334                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rfer_1309 (gpmA)
   01230 Biosynthesis of amino acids
    Rfer_1309 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_1309 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Rfer_1309 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rfer_1309 (gpmA)
Enzymes [BR:rfr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rfer_1309 (gpmA)
Exosome [BR:rfr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rfer_1309 (gpmA)
  Exosomal proteins of melanoma cells
   Rfer_1309 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1402325..1403068)
Genome map
AA seq 247 aa AA seqDB search
MYKLVLIRHGESTWNLDNRFTGWTDVDLTPLGIEQAKNAGRLLKAEGYEFDVAYTSVLKR
ATRTLWHVLDEMDRTWLPVVNSWRLNERHYGALQGLNKAETAKQYGDAQVLAWRRSYDTP
PPALEPTDPRSERADRRYARLSQDQVPLTECLKDTVARVMPFWYEALAPAIKAGKRVVVA
AHGNSIRALVKYLDNISDDDIVGLNIPNGIPLVYELDENLKPIRHYYLGDAEAAAKAAAA
VASQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatccacctggaaccttgacaaccgcttc
accggctggaccgacgtggatttgacccccctcggcatcgaacaggccaaaaatgccggg
cgcctgctcaaggccgaaggctatgaatttgatgtcgcctacaccagcgtcctcaagcgc
gccacccgcaccctgtggcacgtgctcgatgagatggaccgcacctggctgccggtggtc
aacagctggcgcctcaacgagcgccactacggcgccttgcagggcctcaacaaggccgaa
accgccaaacaatatggcgacgcccaggtactggcctggcggcgcagctacgacacaccc
ccacccgcactggagccgaccgacccgcgcagcgagcgcgctgatcgacgctacgcccga
ctgtcacaagaccaagtgcccctgaccgagtgcctgaaggacacggtggcgcgggtcatg
cctttttggtacgaggcgctggcgcccgccatcaaagcgggcaaacgcgtcgtggtggca
gcccatggcaactcgatccgggcgctggtgaaatacctggacaacatctccgacgacgac
atcgtgggcctgaacatcccgaacggcattccgctggtctatgaactcgacgagaacctc
aagcctatccgccactactacctgggcgatgccgaggctgcagccaaagcggctgcggcc
gtggcctcgcaaggtaaagcttga

DBGET integrated database retrieval system