KEGG   Rhodoferax ferrireducens: Rfer_1328Help
Entry
Rfer_1328         CDS       T00334                                 

Definition
(GenBank) Tryptophan synthase, beta chain-like
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00260  Glycine, serine and threonine metabolism
rfr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01130  Biosynthesis of antibiotics
rfr01230  Biosynthesis of amino acids
Module
rfr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rfer_1328
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rfer_1328
Enzymes [BR:rfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rfer_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABD69062
JGI: Rfer1328
UniProt: Q21YU1
Position
1426985..1428355
Genome map
AA seq 456 aa AA seqDB search
MSKQTKFLLNEDQMPKFWYNLQADLPKPMPAVLHPGTLQPVGPDDLAPLFPMALIMQEVS
QEREIEIPEPVRDVFRLWRPAPLFRAHRLEKALGTPAKIYYKYEGGSPAGSHKPNTAVPQ
AFYNQEAGIKRLVTETGAGQWGSSLAFAGSLYGLEVEVFQVRVSYDQKPYRRALMETYGA
RCVASPSHETVYGRSVLAKNPNHPGSLGIAISEAVELAVQREDTKYALGSVLNHVLLHQT
IIGQEAMLQMQMANDWPDVVVGCAGGGSNLAGIAFPFIGHGLRGGQKPRIVAVEPAACPT
LTRGKYAYDFGDTGHMTPLTKMYTLGSQFTPPGFHAGGLRYHGMAPLVSHCKALGLLEAV
AYDQVACFEAGVLFARNEGIVPAPESNHAIKGAIEEAMRCKREGKAETILFCLSGHGHFD
MTSYQKYFAGELTDEHYDETELALALASLPNVPETV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcagaccaagtttcttttgaacgaagaccagatgccaaaattttggtacaac
ctgcaggccgatttgcccaagccgatgccagccgtgctgcatccgggcaccctgcagcca
gtcgggcccgatgacctggcacccttgttccccatggcgctgatcatgcaggaggtgagc
caggagcgcgagatcgagattcctgagccggtgcgcgatgtgtttcggctgtggcggcca
gcaccgctgtttcgcgcccaccgccttgaaaaagcgctcggcacgccggccaagatttat
tacaaatacgagggtggcagcccggcgggtagccacaagcccaacaccgccgtgccgcag
gcgttctacaaccaagaggccggcatcaagcggctggtgaccgaaaccggggccggccag
tggggctcctcgctggcctttgccggctcgctctacggcctggaagttgaagtgtttcag
gtgcgtgtgtcgtacgaccaaaaaccgtatcggcgcgccttgatggaaacctatggtgcg
cgttgtgtcgcctcaccctcccatgagacggtgtatggccgctccgtgctggccaagaac
ccgaaccatccgggcagcctgggcattgcgatctcggaagcggtggagctcgccgtgcag
cgcgaggacaccaaatacgcgctcggctcggtgctcaaccatgtgctgttgcaccagacc
atcatcgggcaagaggccatgctgcagatgcaaatggccaatgactggcccgatgtggtg
gtgggttgtgccggcggcggctccaatctggcgggcattgcttttcccttcatcgggcac
ggcttgcgaggtggccagaaaccacgcatcgtggcggttgaaccggcggcttgccccacg
ctgacgcgcggcaaatacgcctacgactttggcgacaccgggcacatgacacctttgacc
aagatgtacacgctgggcagtcagttcacgccgccgggctttcatgcgggcggcctgcgc
taccacggcatggcacccctggtgtcgcattgcaaggccttggggctgttagaggcggtg
gcctatgaccaggtggcgtgttttgaagccggcgtgctgtttgcgcgcaacgagggtatc
gtgcccgcgcccgagtccaaccacgcgatcaagggcgcgattgaagaggccatgcgctgc
aagcgcgagggcaaggcagagaccatcctgttttgcctgagtgggcacggtcatttcgac
atgacgtcctaccagaagtactttgccggtgagttgaccgacgagcattacgacgagacc
gagttggcgctggcgctggccagtttgccgaacgtgccggaaacggtgtga

DBGET integrated database retrieval system