KEGG   Rhodoferax ferrireducens: Rfer_1328Help
Entry
Rfer_1328         CDS       T00334                                 

Definition
(GenBank) Tryptophan synthase, beta chain-like (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rfer_1328
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rfer_1328
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rfer_1328
Enzymes [BR:rfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rfer_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1426985..1428355
Genome map
AA seq 456 aa AA seqDB search
MSKQTKFLLNEDQMPKFWYNLQADLPKPMPAVLHPGTLQPVGPDDLAPLFPMALIMQEVS
QEREIEIPEPVRDVFRLWRPAPLFRAHRLEKALGTPAKIYYKYEGGSPAGSHKPNTAVPQ
AFYNQEAGIKRLVTETGAGQWGSSLAFAGSLYGLEVEVFQVRVSYDQKPYRRALMETYGA
RCVASPSHETVYGRSVLAKNPNHPGSLGIAISEAVELAVQREDTKYALGSVLNHVLLHQT
IIGQEAMLQMQMANDWPDVVVGCAGGGSNLAGIAFPFIGHGLRGGQKPRIVAVEPAACPT
LTRGKYAYDFGDTGHMTPLTKMYTLGSQFTPPGFHAGGLRYHGMAPLVSHCKALGLLEAV
AYDQVACFEAGVLFARNEGIVPAPESNHAIKGAIEEAMRCKREGKAETILFCLSGHGHFD
MTSYQKYFAGELTDEHYDETELALALASLPNVPETV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcagaccaagtttcttttgaacgaagaccagatgccaaaattttggtacaac
ctgcaggccgatttgcccaagccgatgccagccgtgctgcatccgggcaccctgcagcca
gtcgggcccgatgacctggcacccttgttccccatggcgctgatcatgcaggaggtgagc
caggagcgcgagatcgagattcctgagccggtgcgcgatgtgtttcggctgtggcggcca
gcaccgctgtttcgcgcccaccgccttgaaaaagcgctcggcacgccggccaagatttat
tacaaatacgagggtggcagcccggcgggtagccacaagcccaacaccgccgtgccgcag
gcgttctacaaccaagaggccggcatcaagcggctggtgaccgaaaccggggccggccag
tggggctcctcgctggcctttgccggctcgctctacggcctggaagttgaagtgtttcag
gtgcgtgtgtcgtacgaccaaaaaccgtatcggcgcgccttgatggaaacctatggtgcg
cgttgtgtcgcctcaccctcccatgagacggtgtatggccgctccgtgctggccaagaac
ccgaaccatccgggcagcctgggcattgcgatctcggaagcggtggagctcgccgtgcag
cgcgaggacaccaaatacgcgctcggctcggtgctcaaccatgtgctgttgcaccagacc
atcatcgggcaagaggccatgctgcagatgcaaatggccaatgactggcccgatgtggtg
gtgggttgtgccggcggcggctccaatctggcgggcattgcttttcccttcatcgggcac
ggcttgcgaggtggccagaaaccacgcatcgtggcggttgaaccggcggcttgccccacg
ctgacgcgcggcaaatacgcctacgactttggcgacaccgggcacatgacacctttgacc
aagatgtacacgctgggcagtcagttcacgccgccgggctttcatgcgggcggcctgcgc
taccacggcatggcacccctggtgtcgcattgcaaggccttggggctgttagaggcggtg
gcctatgaccaggtggcgtgttttgaagccggcgtgctgtttgcgcgcaacgagggtatc
gtgcccgcgcccgagtccaaccacgcgatcaagggcgcgattgaagaggccatgcgctgc
aagcgcgagggcaaggcagagaccatcctgttttgcctgagtgggcacggtcatttcgac
atgacgtcctaccagaagtactttgccggtgagttgaccgacgagcattacgacgagacc
gagttggcgctggcgctggccagtttgccgaacgtgccggaaacggtgtga

DBGET integrated database retrieval system