KEGG   Rhodoferax ferrireducens: Rfer_1335Help
Entry
Rfer_1335         CDS       T00334                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00630  Glyoxylate and dicarboxylate metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01200  Carbon metabolism
Module
rfr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rfer_1335
Enzymes [BR:rfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rfer_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABD69069
JGI: Rfer1335
UniProt: Q21YT4
Position
1437759..1439078
Genome map
AA seq 439 aa AA seqDB search
MPHTINEQLSREQQVAALEKDWATNPRWKGIKRGYSAADVVRLRGSFQIEYTLARRGAEK
LWNLLHTEDYVNCLGALTGGQAMQQVKAGVKAIYLSGWQVAADGNTSMSMYPDQSLYAVD
SVPTMVERINNAFRRADEIQHSRGIDAGDTGYVDNFAPIVADAEAGFGGVLNGFELMKNM
IRSGAAGVHWEDQLASAKKCGHMGGKVLVPTNEAIQKLIAARMAADVCGVPTLVIARTDA
EAADLLTSDYDENDKPFLTGERTAEGFYKSRKGLDQAISRAVAYADYADLVWCETGTPDL
EFARKFAQAVRAKHPGKLLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKYQFITLAGI
HSMWFNMFDLAQDYVKRGMTAYIEKVQEPEFAARARGYTFVSHQQEVGTGYFDEVTTVIQ
GGKSNVTALTGSTEEEQFH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccacacaccatcaacgagcaattgagccgcgaacaacaagtcgccgcactggaaaaa
gactgggccaccaacccgcgctggaagggtatcaagcgcggctacagcgccgccgatgtg
gtgcgcttgcgcggttcgttccagattgagtacaccctggcgcgccgcggtgccgaaaag
ctctggaacttgttgcacaccgaagactatgtcaattgcctgggcgccttgaccggtggt
caagccatgcagcaggtcaaggccggcgtgaaggcgatttacctgtcgggctggcaagtc
gccgctgacggcaatacgtctatgtcgatgtacccggatcaatccttgtacgcggttgac
tcggtgcccaccatggtcgaacgcatcaacaatgcgttccgccgcgccgacgagatccag
cactcgcgcggcattgacgccggtgacaccggctatgtcgacaactttgcacccatcgtg
gccgacgccgaagccggttttggcggtgtgctcaatggttttgaattgatgaagaacatg
atcaggtccggcgctgcgggcgtgcattgggaagatcaactggcatcggccaagaaatgt
ggccacatgggcggcaaggtgcttgtgcccaccaatgaagcgattcaaaagctgattgca
gcccgcatggcagctgacgtctgcggcgtgccgacgctggtgatcgcccgcaccgatgcc
gaggctgctgacctgctgaccagtgattacgacgaaaacgacaaacctttcctcaccggt
gagcgcaccgccgaaggtttctacaaatcccgcaaaggcctggaccaagccatcagccgc
gccgtggcctacgctgactacgccgacctggtctggtgcgaaaccggcacgcctgacctc
gaatttgcccgcaaatttgcacaggccgtgcgcgccaaacatccgggcaaattgctggct
tacaactgctcgccgtcgttcaactggaagaaaaacctcgacgacgccaccattgccaag
ttccagaaagaactcggcgccatgggctacaagtaccagttcatcaccttggccggcatt
cactcgatgtggttcaacatgtttgacctggcgcaggattacgtcaaacgtggcatgacg
gcttatatcgagaaggtccaggagcccgagttcgctgcacgcgctcggggttacaccttt
gtgtcacaccagcaagaagtgggcaccggttactttgacgaagtcaccaccgtgattcag
ggcggcaagtccaatgtgaccgcgctgaccggttccactgaagaagaacagttccattaa

DBGET integrated database retrieval system