KEGG   Rhodoferax ferrireducens: Rfer_1335Help
Entry
Rfer_1335         CDS       T00334                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rfer_1335
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rfer_1335
Enzymes [BR:rfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rfer_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1437759..1439078
Genome map
AA seq 439 aa AA seqDB search
MPHTINEQLSREQQVAALEKDWATNPRWKGIKRGYSAADVVRLRGSFQIEYTLARRGAEK
LWNLLHTEDYVNCLGALTGGQAMQQVKAGVKAIYLSGWQVAADGNTSMSMYPDQSLYAVD
SVPTMVERINNAFRRADEIQHSRGIDAGDTGYVDNFAPIVADAEAGFGGVLNGFELMKNM
IRSGAAGVHWEDQLASAKKCGHMGGKVLVPTNEAIQKLIAARMAADVCGVPTLVIARTDA
EAADLLTSDYDENDKPFLTGERTAEGFYKSRKGLDQAISRAVAYADYADLVWCETGTPDL
EFARKFAQAVRAKHPGKLLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKYQFITLAGI
HSMWFNMFDLAQDYVKRGMTAYIEKVQEPEFAARARGYTFVSHQQEVGTGYFDEVTTVIQ
GGKSNVTALTGSTEEEQFH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccacacaccatcaacgagcaattgagccgcgaacaacaagtcgccgcactggaaaaa
gactgggccaccaacccgcgctggaagggtatcaagcgcggctacagcgccgccgatgtg
gtgcgcttgcgcggttcgttccagattgagtacaccctggcgcgccgcggtgccgaaaag
ctctggaacttgttgcacaccgaagactatgtcaattgcctgggcgccttgaccggtggt
caagccatgcagcaggtcaaggccggcgtgaaggcgatttacctgtcgggctggcaagtc
gccgctgacggcaatacgtctatgtcgatgtacccggatcaatccttgtacgcggttgac
tcggtgcccaccatggtcgaacgcatcaacaatgcgttccgccgcgccgacgagatccag
cactcgcgcggcattgacgccggtgacaccggctatgtcgacaactttgcacccatcgtg
gccgacgccgaagccggttttggcggtgtgctcaatggttttgaattgatgaagaacatg
atcaggtccggcgctgcgggcgtgcattgggaagatcaactggcatcggccaagaaatgt
ggccacatgggcggcaaggtgcttgtgcccaccaatgaagcgattcaaaagctgattgca
gcccgcatggcagctgacgtctgcggcgtgccgacgctggtgatcgcccgcaccgatgcc
gaggctgctgacctgctgaccagtgattacgacgaaaacgacaaacctttcctcaccggt
gagcgcaccgccgaaggtttctacaaatcccgcaaaggcctggaccaagccatcagccgc
gccgtggcctacgctgactacgccgacctggtctggtgcgaaaccggcacgcctgacctc
gaatttgcccgcaaatttgcacaggccgtgcgcgccaaacatccgggcaaattgctggct
tacaactgctcgccgtcgttcaactggaagaaaaacctcgacgacgccaccattgccaag
ttccagaaagaactcggcgccatgggctacaagtaccagttcatcaccttggccggcatt
cactcgatgtggttcaacatgtttgacctggcgcaggattacgtcaaacgtggcatgacg
gcttatatcgagaaggtccaggagcccgagttcgctgcacgcgctcggggttacaccttt
gtgtcacaccagcaagaagtgggcaccggttactttgacgaagtcaccaccgtgattcag
ggcggcaagtccaatgtgaccgcgctgaccggttccactgaagaagaacagttccattaa

DBGET integrated database retrieval system