KEGG   Rhodoferax ferrireducens: Rfer_1491Help
Entry
Rfer_1491         CDS       T00334                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rfer_1491 (tpiA)
   01230 Biosynthesis of amino acids
    Rfer_1491 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_1491 (tpiA)
   00051 Fructose and mannose metabolism
    Rfer_1491 (tpiA)
   00562 Inositol phosphate metabolism
    Rfer_1491 (tpiA)
Enzymes [BR:rfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rfer_1491 (tpiA)
Exosome [BR:rfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rfer_1491 (tpiA)
  Exosomal proteins of bladder cancer cells
   Rfer_1491 (tpiA)
  Exosomal proteins of melanoma cells
   Rfer_1491 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1605357..1606100
Genome map
AA seq 247 aa AA seqDB search
MRKKLIAGNWKMNGSLAANEALVKGLRVGVGASVCQVALCVPSVYLAQCQALLVGTAIAL
GAQDLSQHEVGAFTGEISGAMLQEFGVRYCIVGHSERRQYHFETDALVAAKAQRALACGI
TPIVCVGETLAEREAGRTEEVVKRQLAAVIHANGHCISEVVVAYEPVWAIGTGKTASIEQ
AQQVHSVLRQQLQAASIQADRIQIIYGGSMNAANAAELLAQPDIDGGLVGGASLKVPDFL
SIIASAC
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaagctgatcgcaggcaactggaaaatgaacggcagtctggctgccaatgag
gcccttgtgaaaggtcttcgagttggggtgggcgcgtcagtctgtcaggtcgcgttgtgt
gtgccgtcggtctatctggcgcaatgccaggcgctgcttgttggcactgccattgctctg
ggtgcgcaggatctttcccagcatgaggtgggcgccttcacgggtgaaatttctggggcc
atgcttcaggaatttggtgtacgttattgcatcgttggtcattccgagcgtcgtcaatat
cactttgagacggatgccctcgttgcagccaaagcgcagcgggctctggcctgtggcatc
acgccgattgtgtgtgtcggcgagaccctggctgagcgcgaagctggcaggaccgaagaa
gtcgtcaagcgtcaactggcggcggtgattcacgccaatggtcactgcatcagcgaggtt
gtagtggcctacgagccggtgtgggccatcggaacgggcaagacagccagcatcgagcaa
gcgcagcaagtgcactcggtgctgcgccaacagttgcaggccgcttcaatccaggcggat
cgtattcagataatttacggcggcagcatgaatgctgcgaacgccgcggagttgctggct
cagccagatatcgatggtggcctggtgggtggtgcctcgctcaaggtcccggatttttta
tcaattattgcttctgcttgctga

DBGET integrated database retrieval system