KEGG   Rhodoferax ferrireducens: Rfer_1573Help
Entry
Rfer_1573         CDS       T00334                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00071  Fatty acid degradation
rfr00280  Valine, leucine and isoleucine degradation
rfr00281  Geraniol degradation
rfr00310  Lysine degradation
rfr00360  Phenylalanine metabolism
rfr00362  Benzoate degradation
rfr00380  Tryptophan metabolism
rfr00410  beta-Alanine metabolism
rfr00627  Aminobenzoate degradation
rfr00640  Propanoate metabolism
rfr00650  Butanoate metabolism
rfr00903  Limonene and pinene degradation
rfr00930  Caprolactam degradation
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01212  Fatty acid metabolism
Module
rfr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rfer_1573
   00650 Butanoate metabolism
    Rfer_1573
  Lipid metabolism
   00071 Fatty acid degradation
    Rfer_1573
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rfer_1573
   00310 Lysine degradation
    Rfer_1573
   00360 Phenylalanine metabolism
    Rfer_1573
   00380 Tryptophan metabolism
    Rfer_1573
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rfer_1573
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rfer_1573
   00281 Geraniol degradation
    Rfer_1573
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rfer_1573
   00627 Aminobenzoate degradation
    Rfer_1573
   00930 Caprolactam degradation
    Rfer_1573
Enzymes [BR:rfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rfer_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 HA2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABD69305
JGI: Rfer1573
UniProt: Q21Y48
Position
complement(1702071..1702850)
Genome map
AA seq 259 aa AA seqDB search
MNYELITIRTEADKIGILTLNRPKQLNALNDQLMTELGAALKAFDSDPAIACMIITGSEK
AFAAGADIGAMAQLSFADAYKSDFITRNWEQIRSVRKPVIAAVSGFALGGGCELAMMCDF
IIAADNARFGQPEIKLGIIPGAGGTQRLPRALGKAKAMDLILTGRMMDALEAERAGLVSR
VVPLDKLMEEALGAALMIAEYSQIATMAAKESVNRAFEGTLSDGIIFERRLFHALFATAD
QKEGMDAFVNKRKANFQHQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaactgatcacgattcgcaccgaagccgacaaaattggcatcctgaccctg
aatcgaccgaagcaactcaacgcgctgaacgaccagttgatgaccgagttgggtgcggcg
ctcaaagcttttgacagcgacccggcgattgcctgcatgatcatcacagggagcgaaaaa
gcctttgccgccggggccgacatcggcgccatggcccaactcagttttgccgacgcctac
aaaagcgacttcatcacgcgcaactgggagcaaattcgcagtgttcgcaaaccggtcatt
gcggcggtcagcggttttgcgctgggcggtggctgcgagcttgccatgatgtgcgacttc
atcatcgcggctgacaatgcccggtttggccaacccgaaatcaagcttggcatcattccc
ggcgccggcggcacgcaacggctgccacgcgcgctcggcaaggccaaggcgatggacctg
atactcaccggccgcatgatggacgctctggaggccgagcgcgcgggcctggtcagccgc
gtggtgccgctggacaaactgatggaagaagcgttgggcgcagccctgatgatcgccgag
tactcgcagattgccaccatggccgccaaggaatccgtcaaccgggcatttgagggcacg
ctgagtgatggcatcattttcgagcgccgcctgttccacgcgctgtttgccaccgccgat
caaaaagaaggcatggacgcttttgtgaacaaacgcaaggcgaatttccagcaccaataa

DBGET integrated database retrieval system