KEGG   Rhodoferax ferrireducens: Rfer_1575Help
Entry
Rfer_1575         CDS       T00334                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rfr  Rhodoferax ferrireducens
Brite
Enzymes [BR:rfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Rfer_1575
Secretion system [BR:rfr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Rfer_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1704869..1705612)
Genome map
AA seq 247 aa AA seqDB search
MNERMNGQVKMKLAKSALLCATVLLALGVSAQEATIRKNLAERIPQLAKIDEVSKSPMSG
LYEIRVNGTEIYYTDAEGNYLVQGNLIDTKQRRNLTEERVDKLTAIRFDALPFKDAFTIV
RGNGKRKLAVFEDPNCGYCKRFERELQGVDNVTIHLFLYPILSAESIEKSKHIWCAKDKG
KAWQDWMVRDQLPKVASCDSAAITRNVEIGRKYKITGTPTLIFADGTRVPGAIGVADVEK
YLTTAKN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacgcatgaatggacaagtcaagatgaaattagctaaatccgcactgctctgt
gccactgtgttgttggctttgggcgttagcgcacaagaggccaccattcgcaagaatctg
gcggagcgaattccgcaactggcaaaaattgacgaagtcagcaagagcccgatgtcgggc
ttgtatgaaattcgggtcaacggcacggaaatttattacaccgatgccgagggcaattac
ctggttcagggcaatttgatcgacaccaaacagcgccgcaatctgacggaagagcgcgtc
gacaaattaaccgcgatccgttttgacgcgctgcctttcaaggacgccttcaccatcgta
cgcggcaacggcaaacgcaagctggcggtctttgaagaccccaactgcggttactgcaaa
cgctttgagcgcgaactgcaaggcgtggacaatgtgacaattcacctgtttctgtacccg
attctcagcgctgaatccatcgagaaatccaaacacatctggtgcgccaaagacaaggga
aaagcctggcaagactggatggtgcgtgaccagttgcccaaagtggcgagctgcgacagc
gccgccatcacacgcaacgttgagattgggcgcaaatacaagatcacgggcaccccgacg
ctgatcttcgccgacggcacgcgggtgcccggcgcgattggcgtagcggacgttgagaag
tatctgacgacagccaagaactga

DBGET integrated database retrieval system