KEGG   Rhodoferax ferrireducens: Rfer_1659Help
Entry
Rfer_1659         CDS       T00334                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
  KO
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rfer_1659 (ipk)
Enzymes [BR:rfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Rfer_1659 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1790693..1791556
Genome map
AA seq 287 aa AA seqDB search
MKSLYDICAPAKLNLFLHITGRRSDGYHLLQSVFMLIDWCDTLHFDLRVDGQISREDLAT
PLPFDDLVVRAARALKAASGSPLGVHVGIEKCIPAQAGMGGGSSDAASTLLALNHLWRLN
FSLEKLISIGLQLGADVPFFLGGHNAWVEGIGEKMDPVVLPSGRFLVVKPVEGLETRLIF
SDPALKRDSETAIISGFAANAFGFGRNDLQSVAQRLCPGVTQALEWLASRGLSGRMTGSG
SAVFAQTLQDVDLRGAPSGFQVRLCKSLDVHPLVGWAVSDRLSVGSA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcactctacgatatttgcgccccggccaagctcaacctgtttttgcacatcaca
ggcaggagaagcgatggctatcatttgctgcagtcggtcttcatgctgattgattggtgc
gacacactgcattttgacctgcgtgtcgatggacaaatcagccgcgaggatcttgcgacg
cccttgccgtttgacgaccttgttgtccgcgctgcgcgggctctgaaggctgccagcggc
agtccattgggcgttcatgtcgggatcgaaaaatgcattcccgcgcaagcgggcatgggc
ggtggatcttccgatgcggcgtcgaccctgttggcattgaaccatctgtggcggctcaac
ttttcactcgaaaagctaatcagcatcgggctgcaactgggtgccgatgtcccgtttttt
ctgggtggtcacaacgcctgggttgaaggaatcggtgagaaaatggaccctgttgtcctg
ccctcaggtcgctttttggtggtcaagcccgtagaggggctcgaaacaagattaattttc
tcggatccggctctcaaaagggacagtgaaacagctataatttcaggcttcgctgcaaat
gcattcggttttggtcgtaacgacctgcagagtgttgcccaaagactttgtcccggcgtg
acccaagcccttgagtggcttgcatcgcgtggactcagtggtcggatgacaggctctgga
agcgcggtgtttgcacaaacgttgcaagatgttgatctgagaggcgctccaagcgggttt
caggtcaggttgtgtaagagtttggatgttcatcccttggtgggttgggcagtcagcgac
aggttgtcggttgggagcgcttag

DBGET integrated database retrieval system