KEGG   Rhodoferax ferrireducens: Rfer_1754Help
Entry
Rfer_1754         CDS       T00334                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rfer_1754
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Rfer_1754
Enzymes [BR:rfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rfer_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1888083..1889177
Genome map
AA seq 364 aa AA seqDB search
MTQHAPLLIDIAGLSLSGIDRQRLQHPLVGGLILFARNWQSRAQLTQLCRDIKKVRRDLL
ICVDHEGGRVQRFKTDGFTHLPPMRALGELWMNDKKGGQGSGAMRATNAASACGFVLGSE
LRACGVDFSFTPVLDLDFGASSVIGDRAFHRDPRVVSLLAKSLMHGLLQSGMANCGKHFP
GHGSVAADSHTAVPVDKRSLKAILADDAAPYGWLNTTLSSVMPAHVIYPKVDARPAGFSS
KWLNDILRGQLGFGGAIFSDDLSMAGARLLDGEPVSYTQAAVAALNAGCDLVLLCNQSLA
SSEGGGGALDAWINGLTEAQLKGAWQPLEASEERRRALLPQTPALPWDDLMLRPDYMHAL
TLVP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacatgcccctctcctcatcgacattgcgggcttgagcctgtccggcattgac
cgccagcgcctgcaacaccccctggtgggggggctgatcctgtttgcccgcaactggcag
agccgcgcccagctgacccagttgtgccgcgacatcaaaaaagtgcggcgtgacttgctg
atctgtgttgaccacgaaggcggccgtgtgcagcgcttcaagaccgatggttttacccat
ttgccgcccatgcgggctttgggcgagctatggatgaatgataagaaaggcggacagggc
agtggtgccatgcgtgccaccaacgccgccagcgcctgcggttttgtgctggggtctgag
ttgcgggcctgcggtgtcgacttcagcttcaccccggtgctggaccttgattttggcgcc
agcagcgtcatcggcgaccgcgccttccatcgtgacccgcgcgtggtgagtctgctggcc
aagagcctgatgcacggcctgctgcaaagcggcatggccaattgcggcaaacactttccg
ggccatggcagcgtggcagccgactcccacaccgccgttcccgtcgataagcgcagcctg
aaagcgattctggctgacgacgccgcgccgtatggctggctgaacaccacgctcagcagt
gtcatgcccgcgcatgtgatctaccccaaggtcgatgcgcggccagcgggtttctcaagc
aaatggttgaacgacatcctgcgcggccaactgggctttggcggtgccatcttcagcgac
gacctgtcgatggccggcgcgcgcctgctcgacggcgagccggtcagctacacccaggcg
gcggtggcggcattgaacgcgggttgtgacctggtgttgttgtgcaaccagtcgctcgcc
agcagcgaaggtggtggcggcgcgctggatgcctggatcaacgggctgaccgaggcacag
ctcaaaggcgcctggcagccgctggaggccagcgaagagcgccgccgcgctctcttgccg
caaacacccgcgctgccatgggatgacttgatgctgcgcccggactacatgcacgcgctg
acgctggtgccttag

DBGET integrated database retrieval system