KEGG   Rhodoferax ferrireducens: Rfer_1787Help
Entry
Rfer_1787         CDS       T00334                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rfer_1787
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rfer_1787
Enzymes [BR:rfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rfer_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1923117..1923938)
Genome map
AA seq 273 aa AA seqDB search
MSRIARTFAGLKAQGRKALIPYVTAGFPFPDITPELMHAFVAGGADVIELGVPFSDPSAD
GPVIQKAGDKALAAGIGMVQVLDMVRTFRTRDASTPVVLMGYANPVERYNQKHDRHDGKS
AFVLDAAAAGVDGVLIVDYPPEECEAFAAELKSAGLDLIFLLAPTSTDERMQQVARVASG
YVYYVSLKGVTGSGALDTGAVEAMLPRIRAHVQVPVGVGFGIRDAATARTIGQVADAVVI
GSKIIQLIDEQPRDQVGPVAQKFLCEIRTALDN
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgcccgcactttcgccggcctgaaggcccaagggcgcaaagccctgatt
ccctatgtcacggcaggcttcccctttcccgatatcacgcctgagttgatgcacgcgttt
gtcgccggcggcgccgatgtgatcgagctgggcgtgcccttttccgaccccagtgcggat
ggcccggtgattcaaaaggccggcgacaaagcactggccgcgggcattggcatggtgcag
gtgctggacatggtgcgcacctttcgcacccgggatgcgagcacaccggtggtgctgatg
ggctacgccaacccagtggagcgctacaaccagaagcatgaccgccacgacggcaagagt
gcttttgtgcttgatgctgcggcagccggtgtggacggcgttctgatcgtcgattacccg
cccgaagaatgcgaggcctttgccgccgagctcaaaagtgcggggctggacctgatcttt
ttgctcgcccccaccagtaccgacgagcgcatgcagcaggtcgcgcgggtggccagtggc
tatgtgtactacgtctcgctcaagggtgtcaccggatcgggcgcgctcgacaccggtgcc
gtcgaggcgatgctgccgcgcatccgggcccatgtgcaggtgccggtcggtgtcggtttt
ggcattcgcgatgccgccactgcccgcaccatcgggcaggtcgccgatgcggtggtcatc
gggagcaaaatcatccagttgattgatgaacagccgcgggaccaggtgggcccggtagcg
caaaaatttttatgtgaaatccgcaccgcgctcgataattga

DBGET integrated database retrieval system