KEGG   Rhodoferax ferrireducens: Rfer_1788Help
Entry
Rfer_1788         CDS       T00334                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rfer_1788
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rfer_1788
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rfer_1788
Enzymes [BR:rfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rfer_1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1923935..1925242)
Genome map
AA seq 435 aa AA seqDB search
MFEYQQPDPRGHFGIYGGSFVSETLTHAINELKAAYAKYQFDPAFVAEFNYELAHFVGRP
SPVYHADRMSREQGGAQIFLKREDLNHTGAHKINNTIGQAMLARRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGSEDVKRQSPNVYRMNLLGATVVPVESGSRTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGKECLVQMPEMLQAAGCHTTQPDAVVA
CVGGGSNAMGIFHPYIAHEATRLIGVEAAGLGMDSGKHSASLQRGSPGVLHGNRTYVLQD
DNGQVTETHSISAGLDYPGVGPEHAFLKDIGRAEYVGITDQEALAAFHYLCRTEGIIPAL
ESSHAVAYAMKLAKTMRPDQSILVNLSGRGDKDIGTVADLSHADFYCRPSCKGQSVKGAD
NAQPSANQQVVKVAQ
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagtatcaacaacccgacccgcgtggccacttcggcatttacggcggcagcttt
gtctccgaaacgctgacgcatgccatcaacgaactcaaggcggcttacgccaagtaccag
tttgacccggccttcgtcgccgaattcaactacgagctggcccacttcgtcggccgtcct
tcgccggtttaccatgccgatcgcatgagccgggaacagggcggcgcgcagatctttctc
aagcgcgaagacctgaaccacaccggcgcccacaagatcaacaacaccatcggccaggcc
atgctggccagacgcatgggcaagccgcgcgtcattgccgaaaccggcgccggccagcac
ggcgtggccacggccaccatctgcgcccgctacggtctggaatgcgtggtctacatgggc
agtgaagacgtcaagcggcaaagccccaatgtgtaccgcatgaatctgctgggcgccacg
gtggtgccggtcgagagcggcagccgaaccctcaaagatgccttgaacgaggccatgcgc
gactgggtggccaacgtggacaacactttttacatcatcggcacggtcgccggaccacac
ccctacccgatgatggtgcgcgattttcagagcgtcatcggcaaggaatgcctggtgcaa
atgcccgaaatgctgcaagccgcagggtgccatacaacgcaacccgatgcggtggtggct
tgcgtcggcggcggctccaacgcgatgggtatttttcacccctatattgcgcatgaagcc
acacgcctgatcggcgtcgaggcagccggccttggcatggacagcggcaaacactcggcg
tccctgcaacgtggcagtccgggcgtgctgcacggcaaccgcacctacgtgctgcaagac
gacaacgggcaagtgaccgaaacccacagcatcagcgccgggctggactaccctggcgtc
ggcccggaacatgccttcctcaaggacatcggccgcgccgaatacgtcggcatcaccgac
caggaggcgttggctgccttccattacctgtgccgcaccgaaggcatcattccggcgctc
gaatcgagccacgccgtggcgtatgccatgaagcttgcgaaaaccatgcgccccgaccag
tcgatcctggtcaatctgtcgggccgcggcgacaaggacatcggcaccgtggccgacctc
agccacgccgacttttattgccgcccgagttgcaaaggccaatcggtcaaaggcgcagac
aacgcgcagcccagcgccaaccaacaagttgtgaaggtcgcccaatga

DBGET integrated database retrieval system