KEGG   Rhodoferax ferrireducens: Rfer_1800Help
Entry
Rfer_1800         CDS       T00334                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00020  Citrate cycle (TCA cycle)
rfr00190  Oxidative phosphorylation
rfr00650  Butanoate metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
Module
rfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rfr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rfer_1800
   00650 Butanoate metabolism
    Rfer_1800
  Energy metabolism
   00190 Oxidative phosphorylation
    Rfer_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF1211
Motif
Other DBs
NCBI-ProteinID: ABD69529
JGI: Rfer1800
UniProt: Q21XH4
Position
complement(1938696..1939061)
Genome map
AA seq 121 aa AA seqDB search
MSVNFGPHRLVVGAHYGMRDWLSQRVTAVLMALFTVLVLAELIFTKGPIGYAQWAGIFSP
QWMKALTFTVILSLLYHVWVGMRNIFQDYVHPYGVRFVLDVFAIVWLVSCAGWGIQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttaattttggtcctcatcgccttgttgtcggagctcactacggtatgcgcgac
tggctttcccaacgtgtgaccgctgtcctgatggcgctgtttaccgtgctggttctggcc
gagcttatatttaccaagggccctatcggctatgcccaatgggccggtattttttcaccg
caatggatgaaggctttgacctttaccgtcatcctctccctgctctaccacgtgtgggtt
ggcatgcgtaacatcttccaggactacgtccatccctatggcgttcgctttgtcctggac
gtatttgccatcgtctggctggtcagctgcgcaggctggggcattcaagtcttgtggcgc
ctgtaa

DBGET integrated database retrieval system