KEGG   Rhodoferax ferrireducens: Rfer_1913Help
Entry
Rfer_1913         CDS       T00334                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rfer_1913
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rfer_1913
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rfer_1913
Enzymes [BR:rfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rfer_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2054196..2055623
Genome map
AA seq 475 aa AA seqDB search
MNYISTRGDMSRKHFCEILLEGLAPDGGLYLPESYPHVDDATLTRWRAVYHQEGYAELAF
EILSLYIDDIPAPDLRSICHKTYTAEVFGTGEIVPLRHLENGLWLEALSNGPTLAFKDLA
MQLLGNLFEYELARRGEELNILGATSGDTGSAAEYAMRGKKGVRVFMTSPANRMSPFQQA
QMFSLLDENIHNIAVDGVFDDCQDMVKAVSNDLEFKRKYKIGTVNSINWARLLAQVVYYF
AGYFQATETNAEKVSFTVPSGNFGNVCAGHVARMMGLPIAKLVVATNENDVLDEFFKTGV
YRVRSSADTHETSSPSMDISKASNFERFVFDLLGRDGARVKALFGDALARTGRFDLSQHP
AFNQSTLRYGFQSGQSTHADRLATIKDSFERFGMLIDTHTADGVKVAREHLQPGVPMIVM
ETALPIKFAATIVEALGREPDRPAKFVGIEALPKRVTRMAADVEAVKAYIAEHCA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctctacccgtggcgacatgagtcgcaagcatttttgtgaaatcctgctc
gaaggcctggcgcccgacggcggcttgtacctgcccgaaagttatccgcatgtggacgac
gccacgctgacccgctggcgcgcggtgtaccaccaggagggctatgccgagctggcgttc
gagattttgtcgctctatatcgacgacattcctgcgcccgacttgcgctcgatttgccac
aagacctacaccgccgaggtgtttggtaccggcgaaattgtgccgctgcgccacctggag
aatggactctggttggaggccctgtccaatggcccgacgctggctttcaaggacctggcg
atgcagttgctgggtaacctgtttgagtacgagctggcgcgccgcggtgaagagctcaac
attctgggcgccaccagcggcgacaccggcagcgccgccgagtacgccatgcgcggcaaa
aaaggcgtgcgcgtcttcatgaccagcccggcgaatcgcatgagcccgttccagcaggcg
cagatgttcagcctgttggacgagaacattcacaacattgccgtcgacggcgtgtttgat
gattgccaggatatggtcaaggccgtgtccaacgaccttgagttcaaacgcaaatacaag
atcggcacggtcaactccatcaactgggcgcgcctgctggcccaggtggtgtactacttt
gccggttacttccaggccaccgaaaccaatgccgagaaggtcagcttcacggtacccagc
ggcaactttggcaatgtctgcgccggtcatgtggctcgcatgatgggcctgccgatcgcc
aagctggtggtggccaccaatgaaaacgacgtgctggacgagttttttaaaaccggtgtc
taccgcgtgcgcagcagtgccgacacgcatgagacatcgagtccgtcgatggatatctcc
aaagcgtccaactttgagcgctttgtgtttgacctgctgggccgtgatggggcccgggtc
aaggccttgtttggggatgcgctggcccgcaccggccgctttgatttgagtcagcacccg
gcctttaaccagagcaccttgcgctatggctttcagagcggccagagcacccatgcggat
cgcctcgccaccatcaaagacagctttgagcgctttggcatgctgatcgacacacacacc
gcagacggcgtcaaggtggcgcgtgagcatttgcagccgggggtgccgatgatcgtgatg
gagacggccttgcccatcaagtttgccgccacgattgtggaggcgctcgggcgtgagccg
gatcgcccagccaaatttgtcggcatcgaagccttgcccaagcgtgtgacccgcatggcg
gctgatgttgaggcggtcaaggcctatattgccgagcactgcgcatga

DBGET integrated database retrieval system