KEGG   Rhodoferax ferrireducens: Rfer_2012Help
Entry
Rfer_2012         CDS       T00334                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rfr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2169355..2170233
Genome map
AA seq 292 aa AA seqDB search
MKWNTARFLIDLSRPQVMGIVNITPDSFSDGGQHASTAAALRHCETLLKEGADILDIGGE
STRPGALSLPLDEELARVLPVVREAVRLGVPVSVDTYKPRVMQAVLDLGADIINDIWALR
WTEPCANPAPAALNAMQVVAKHPSCGVCLMHMHREPLTMQMAPMEGDVVPQVLLFLEHLA
QSLHGLGVEKNRIVIDPGIGFGKTVAQNFALLARQGELLGAGYPLLVGWSRKSSLAAITA
TPLAAAATLDVHERLVPSVAAALLAVERGAAIVRVHDVRETVQALKVLGAIR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggaacacggcccgattcctgattgacctcagccgcccccaggtgatgggcatt
gtcaatatcacacccgattcgttctcggacggtggtcagcacgcatccaccgcagcggct
ctgcggcactgtgagacgctgctcaaagagggggctgacattctggatatcgggggggag
tcgacccgtcccggcgctttgtccttgccactggatgaggagttggcgcgggtgctgcct
gtggtgcgtgaagcggttcgcttgggtgtgccggtatcggtcgatacctacaagccaagg
gtcatgcaagccgtgctggaccttggcgctgacatcatcaacgacatttgggctctgcgt
tggactgagccctgtgccaaccccgcacccgctgccttgaacgccatgcaagtggtggca
aaacaccccagttgtggcgtctgtctgatgcacatgcaccgtgaacccttgacgatgcag
atggcccccatggagggggacgtggtgccgcaggtgctattatttttggagcatttggcc
caatcgttgcatgggctaggggtagaaaagaatcgtatcgttattgaccccggcattggc
tttggcaagaccgtggcacagaattttgcgctactggcacggcagggtgagctgctgggt
gcgggttatccgctgctggtcggttggtcgcgaaaatcatcattggcagcgatcacagcc
accccgctggccgccgcggcgacactggatgttcatgagcgcctggtgcccagtgtggcc
gctgcgttgttggccgtggagcgtggcgcagccattgtccgtgtgcatgacgtgcgggaa
accgtgcaggctctcaaggtgctcggcgctataagatag

DBGET integrated database retrieval system