KEGG   Rhodoferax ferrireducens: Rfer_2044Help
Entry
Rfer_2044         CDS       T00334                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00300  Lysine biosynthesis
rfr01100  Metabolic pathways
rfr01120  Microbial metabolism in diverse environments
rfr01230  Biosynthesis of amino acids
Module
rfr_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rfer_2044
Enzymes [BR:rfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rfer_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABD69769
JGI: Rfer2044
UniProt: Q21WT4
Position
complement(2211926..2213101)
Genome map
AA seq 391 aa AA seqDB search
MPKTLHLAEQLIARPSLTPDDAGCQQIIAERLAPLGFSCETITSGPADFRVTNLWAKRAA
APVKSAQHTTKLVVFAGHTDIVPSGPVQQWRCHPFTPTQFDGKLYGRGAADMKTSLAAFV
VAVEEFLTAQPDTALAIGFLLTSDEEGPALDGTVKVCEALQARGERIDYCIVGEPTSLER
TGDMIKNGRRGTLSARLTVKGVQGHIAYPHLAKNPIHLVAPALAELVGVEWDRGNAFFPP
TSWQISNIHSGTGASNVIPGAVVIDFNFRFSTESTPESLQTRLAAVLERHELDYELAWTL
GGTPFLTEPGTLVDAVVDAIKQETGLTTVLSTTGGTSDGRFIARICPQVIEFGPPNASIH
KIDEHINVADIEPLTNIYRRVLENLSAGLSA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactctgcacctggccgaacaactgatcgcccgcccctcgctcacgcccgat
gatgccggctgccagcaaatcatcgctgaacgactcgccccgctgggctttagctgtgaa
accatcaccagcggcccggctgatttccgcgtcaccaatttgtgggcaaaacgggctgca
gcccccgtcaaatctgcgcaacacactaccaaattagtagtttttgccggccacaccgac
atcgtgcccagcggcccggtgcagcaatggcgctgccatccgttcacacccacccagttc
gatggcaagttgtacggtcgcggcgcggccgacatgaaaacctcgctggcggcgttcgtc
gtcgcggttgaagagtttttgacggcccagccggacacggctttggccatcggttttttg
ctcaccagcgacgaagaaggcccggcgctggatggcacggtcaaagtctgtgaagcgctg
caggcgcgcggcgaacgcatcgattactgcatcgtcggtgagcccacctccctggagcgc
accggcgacatgatcaaaaacggccgccgcggcacgctcagcgcccgcttgaccgtcaaa
ggtgtgcaaggccatatcgcctacccgcacctggccaaaaacccgattcatctggtcgca
cccgcgctggccgagttggtgggcgtcgaatgggaccggggcaacgcgttcttcccgccc
acctcctggcagatcagcaacatccacagcggcaccggcgccagcaatgtgattccgggc
gcggtggtgattgacttcaacttccgcttttccaccgagtccacacccgagtcgctgcag
acccggctggctgcggtgctggagcgccacgagctcgactacgagctggcgtggacgctc
ggtggcacgccgttcctgaccgagcccggcacactggtcgacgcggtggtggacgcgatc
aaacaagagaccggcctgaccaccgttctctccaccaccgggggcaccagcgacggccgt
tttattgccagaatttgcccccaggtcatcgagttcggcccgcccaatgccagcatccac
aagatcgacgaacacatcaacgttgccgatatcgagcctttgacaaacatctaccggcgc
gtgctggagaacctgagtgcggggctgagcgcatga

DBGET integrated database retrieval system