KEGG   Rhodoferax ferrireducens: Rfer_2049Help
Entry
Rfer_2049         CDS       T00334                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rfr  Rhodoferax ferrireducens
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rfer_2049
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rfer_2049
Enzymes [BR:rfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Rfer_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2216794..2218239)
Genome map
AA seq 481 aa AA seqDB search
MGADNNVSTAETRPTPTAAAVNQPSTSTSTSERSTSRSLRERLAGTLRHKDEALSPRLLR
RTLTELQTVVDSQVSEVEGGRRASQFALWYATASPAQRRDCWLLMSEQFAPDPDIVETAR
GHYEAAQNTPDAGQAEISLRRALVSPRSRLLQRFAAFPEGMQFLLGLRTELLPHLKAEKR
LLALDGELENLFSSWFDVAFLELRRISWDSPASLIEKLIKYEAVHDIRGWNDIKNRLDSD
RRCYGFFHPQLPNEPLIFVEVALLDKLPCAISPLLDEAAAPADLAKATTAIFYSISSTQT
GLRGMSFGDSLIKRVVETLRAEFPRLRTFATLSPMPGFRSWLGKNVTAMLARLDEKTRAA
LASAVGAQPLAAADLLAAAEQAQSLDARSPLRHFLMQCAAHYLGHELAQGKPLDPVTRFH
LGNGARVERLNWGGDLSAKGFKQSYGMMVNYLYDLKRLDKYRAQFANSKLAVSSEVETLG
F
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagataataacgtgtcgacggctgaaacgaggccgacaccgaccgccgcggcc
gtgaaccagccgtcaacgtcgaccagcacgagtgagcgatcgacttcccgctccctgcgc
gaacgcctggcaggcaccttgcgccacaaggacgaggcgctctcaccgcgcttgctgcgt
cgcacactgaccgaactgcagaccgtagtcgacagccaggtcagcgaggtcgaaggcggg
cgccgcgccagtcagttcgcactttggtatgccaccgcctcgcccgcgcagcggcgcgac
tgctggctgctgatgagcgagcagtttgcgcccgaccccgacattgtcgagaccgcgcgc
ggacactacgaggcggcccaaaacacgcccgacgccgggcaagccgagatcagcttgcgc
cgggcgctggtgtcgccgcgcagccgcttgctgcaacgctttgcagcgttccccgaaggc
atgcaatttctgcttggcctgcgcaccgagttgctgccacacctgaaagccgaaaagcgc
ctgctggccctggacggcgagctggaaaaccttttttccagctggtttgacgtggcgttt
ctggagttacgccgcatcagttgggattcgcccgcgtcgctgatcgaaaagctcatcaaa
tacgaagcggtgcatgacattcgcggctggaacgacatcaagaaccggcttgattcggac
cgccgctgctacggttttttccatcctcagttgcccaatgaaccactgatctttgtcgag
gtggccctgctcgacaaactgccttgcgccatctcgccactgctggacgaagcggcggca
ccggccgacctggccaaagccacaaccgccatcttttactccatcagcagcacccagacc
ggtctgcgcggcatgagttttggcgactcgctgatcaagcgcgtggtggagaccctcagg
gccgagtttccccgcctgcgcacttttgccaccctctcgccgatgccgggttttcgcagt
tggctgggcaagaacgtcaccgccatgctggctcggctcgatgaaaagacccgagccgcg
cttgccagtgccgtgggcgcgcagcccttggcggcagcggacctgctggccgccgccgag
caggcgcagtcacttgacgccagatcgccgctgcgccacttcctgatgcaatgcgccgcc
cactacctgggccacgagctggcgcaaggcaagccactggatccggtgacgcgtttccat
ctgggcaatggcgcacgcgtcgagcggctgaactggggcggagatctctcggccaaaggc
ttcaaacaatcctacggcatgatggtcaattacctgtacgacctgaagcggctggacaag
taccgggcgcagtttgccaacagcaaactggcggtttcaagcgaagttgaaacgctgggg
ttttga

DBGET integrated database retrieval system