KEGG   Rhodoferax ferrireducens: Rfer_2117Help
Entry
Rfer_2117         CDS       T00334                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rfr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rfr00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:rfr03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:rfr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rfr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2294285..2294719
Genome map
AA seq 144 aa AA seqDB search
MTEVAFHFNAPDRVAYACRLLRKAAASGAKLVVIGSPDVLQQLDRALWTFSAVDFVPHCF
LESESHVVAASPVILSTSTHAVPHQQVLLNLGQLVPEGFERFERVIEVVGQEDEDRQSAR
SRWKSYADRGYVITRHDLALKTSY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggtggcctttcacttcaatgcacccgaccgggtcgcctatgcctgccgtctg
ctgcgcaaggccgcggcaagtggtgccaagcttgtggtgataggttcgccggacgtgctg
cagcaactggaccgcgccctttggacgttttcagccgttgattttgtgccacattgtttt
ctggagagtgagtcacacgtcgttgccgcttcgcccgtgattttgtcgacatccacccat
gcggtgccccaccagcaggtgcttctcaaccttggccaacttgtgcccgaggggtttgag
cgctttgagcgtgtcatcgaggtggtcggccaggaggacgaagatcgtcagtcggcgcga
agccgctggaaaagttatgccgatcgtggctacgtcatcacacgtcatgatctggctttg
aaaacgtcgtactga

DBGET integrated database retrieval system