KEGG   Rhodoferax ferrireducens: Rfer_2185Help
Entry
Rfer_2185         CDS       T00334                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rfer_2185
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_2185
   00020 Citrate cycle (TCA cycle)
    Rfer_2185
   00620 Pyruvate metabolism
    Rfer_2185
   00640 Propanoate metabolism
    Rfer_2185
   00650 Butanoate metabolism
    Rfer_2185
  Energy metabolism
   00680 Methane metabolism
    Rfer_2185
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rfer_2185
Enzymes [BR:rfr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rfer_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2383618..2384610)
Genome map
AA seq 330 aa AA seqDB search
MEQTLVKFYQTGTFTVGNRLLAPEQRSVQANTQRSNSLNSGHRACQGCGEALGARYAIDA
AMQATNGQLIAANATGCLEVFSTPYPETSWQMPWIHSLFGNTAAVATGIAAAMRVKGRSE
VRVVAQGGDGGTTDIGFGCLSGMFERNDDVLYICYDNEAYMNTGVQRSSATPPAARTATT
MPVGPHPGNEFGQGKNVPQIAMAHEIPYVATATVADLRDLEYKVKKAMSIHGARYIHIFV
PCPLGWGAASHDTIRLARLAVESGVFPVFEAERGEVTGVAKIRRRVPIEDYLKPQKRFAH
LFGKTPDLETIARLQARADRNIRRFGLLDS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacattagtcaagttttaccaaaccggtacttttacggttggtaaccgcctg
ctcgcgcccgagcagcgcagcgtacaggccaacacccagcgcagcaactcgctcaattcc
ggccaccgtgcctgtcagggctgcggcgaagcgctcggcgcgcgctacgccatcgacgcc
gccatgcaggccaccaacggccagttgatagctgccaacgccaccggctgcctggaggtg
ttctccaccccgtaccccgaaacctcctggcaaatgccctggattcactcgctgtttggc
aacacggccgctgtggcaaccggcatcgcggccgccatgcgcgtgaaaggtcgcagtgag
gtgcgggtcgtcgcccagggcggtgacggtggcacgaccgacatcggctttggctgtttg
tcgggcatgtttgagcgtaacgacgatgtgctctatatctgttacgacaacgaggcctac
atgaacactggcgtacagcgctcatcggccacgccaccggcagcgcgcaccgctaccacg
atgcccgtgggaccgcatccaggcaatgaatttggccagggaaaaaatgtgccgcagatt
gccatggcgcatgaaatcccctatgtagccaccgcgacggtggccgacctgcgggatctg
gaatacaaggtcaagaaagccatgtcgattcacggcgcgcgttacatccacatctttgtc
ccctgcccgctcggttggggcgccgcctcacacgacaccattcggctcgcacggctggcc
gttgagagcggtgtatttccggtctttgaagccgaacgcggcgaggtgaccggcgtggcg
aaaatccggcgccgggtgccgattgaggattacctgaaaccacaaaagcgttttgctcac
ctgtttggcaaaacccctgaccttgaaaccattgcacggctgcaagccagggccgaccgc
aacatccgccgctttggcctgctggattcttaa

DBGET integrated database retrieval system