KEGG   Rhodoferax ferrireducens: Rfer_2185Help
Entry
Rfer_2185         CDS       T00334                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00010  Glycolysis / Gluconeogenesis
rfr00020  Citrate cycle (TCA cycle)
rfr00620  Pyruvate metabolism
rfr00633  Nitrotoluene degradation
rfr00640  Propanoate metabolism
rfr00650  Butanoate metabolism
rfr00680  Methane metabolism
rfr01100  Metabolic pathways
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
Module
rfr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_2185
   00020 Citrate cycle (TCA cycle)
    Rfer_2185
   00620 Pyruvate metabolism
    Rfer_2185
   00640 Propanoate metabolism
    Rfer_2185
   00650 Butanoate metabolism
    Rfer_2185
  Energy metabolism
   00680 Methane metabolism
    Rfer_2185
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rfer_2185
Enzymes [BR:rfr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rfer_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ABD69909
JGI: Rfer2185
UniProt: Q21WE4
Position
complement(2383618..2384610)
Genome map
AA seq 330 aa AA seqDB search
MEQTLVKFYQTGTFTVGNRLLAPEQRSVQANTQRSNSLNSGHRACQGCGEALGARYAIDA
AMQATNGQLIAANATGCLEVFSTPYPETSWQMPWIHSLFGNTAAVATGIAAAMRVKGRSE
VRVVAQGGDGGTTDIGFGCLSGMFERNDDVLYICYDNEAYMNTGVQRSSATPPAARTATT
MPVGPHPGNEFGQGKNVPQIAMAHEIPYVATATVADLRDLEYKVKKAMSIHGARYIHIFV
PCPLGWGAASHDTIRLARLAVESGVFPVFEAERGEVTGVAKIRRRVPIEDYLKPQKRFAH
LFGKTPDLETIARLQARADRNIRRFGLLDS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacattagtcaagttttaccaaaccggtacttttacggttggtaaccgcctg
ctcgcgcccgagcagcgcagcgtacaggccaacacccagcgcagcaactcgctcaattcc
ggccaccgtgcctgtcagggctgcggcgaagcgctcggcgcgcgctacgccatcgacgcc
gccatgcaggccaccaacggccagttgatagctgccaacgccaccggctgcctggaggtg
ttctccaccccgtaccccgaaacctcctggcaaatgccctggattcactcgctgtttggc
aacacggccgctgtggcaaccggcatcgcggccgccatgcgcgtgaaaggtcgcagtgag
gtgcgggtcgtcgcccagggcggtgacggtggcacgaccgacatcggctttggctgtttg
tcgggcatgtttgagcgtaacgacgatgtgctctatatctgttacgacaacgaggcctac
atgaacactggcgtacagcgctcatcggccacgccaccggcagcgcgcaccgctaccacg
atgcccgtgggaccgcatccaggcaatgaatttggccagggaaaaaatgtgccgcagatt
gccatggcgcatgaaatcccctatgtagccaccgcgacggtggccgacctgcgggatctg
gaatacaaggtcaagaaagccatgtcgattcacggcgcgcgttacatccacatctttgtc
ccctgcccgctcggttggggcgccgcctcacacgacaccattcggctcgcacggctggcc
gttgagagcggtgtatttccggtctttgaagccgaacgcggcgaggtgaccggcgtggcg
aaaatccggcgccgggtgccgattgaggattacctgaaaccacaaaagcgttttgctcac
ctgtttggcaaaacccctgaccttgaaaccattgcacggctgcaagccagggccgaccgc
aacatccgccgctttggcctgctggattcttaa

DBGET integrated database retrieval system