KEGG   Rhodoferax ferrireducens: Rfer_2213Help
Entry
Rfer_2213         CDS       T00334                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00010  Glycolysis / Gluconeogenesis
rfr00020  Citrate cycle (TCA cycle)
rfr00620  Pyruvate metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
Module
rfr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_2213
   00020 Citrate cycle (TCA cycle)
    Rfer_2213
   00620 Pyruvate metabolism
    Rfer_2213
Enzymes [BR:rfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rfer_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 NQRA RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABD69937
JGI: Rfer2213
UniProt: Q21WB6
Position
2422679..2424367
Genome map
AA seq 562 aa AA seqDB search
MSLIEVKVPDIGDFDEVAVIELLVKPGDTVKAEQSLITVESDKASMEIPSSSAGVVKELK
VALGDKVKQGSLLLLLEVASAEGTAAAAPAAAVPAAAQEFKTNQAVAPVPPAPAATDVAA
SSAGPVEVHVPDIGDFKDVTVIEVMVKVGDAVRLEQSLITVESDKASMEIPSSAAGVIKE
LKVKLGDKVNIGDLLAILEGAAPVAMAAAATAQASAAAAAPLVSAAAAVAPATAVLAVPA
HIPTSAPLGLPHASPSVRKFARELGVPLDEVKGTGLKGRITDNDVQAFTRSVMSGAIQTL
AAQAQPKAAAAAPGADGAGLGLIPWPKVDFAKFGPVERKELSRIKKISGANLLRNAILIP
AVTNHDDCDITDLEAFRVSTNKENEKSGVKVTMLAFLIKACVAALKKYPEFNSSLDGDAL
IYKQYYHIGFAADTPNGLMVPVIKDADQKGIMQISVEMGELAKKARDGKLSPAEMTGASF
TISSLGGIGGRYFTPIINAPEVSILGVCRSTIQPVWDGKAFQPRLMLPLSLTWDHRVIDG
AAAARFNVYLGQILGDFRRVLL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtccttaatcgaagtaaaagtcccggacattggcgattttgatgaagttgccgtgatt
gaactgctggtcaagccgggcgacaccgtcaaggctgaacaaagcctgattaccgtcgag
tccgacaaggcgtcgatggaaattccgtcgtcatcggctggcgtggtcaaggagctcaag
gtcgctttgggcgacaaggtcaagcaaggctcattgttgttgttgctggaggtggctagt
gccgagggcaccgcagctgcagcaccggccgccgcggtgccggcagcagcccaggaattc
aagacaaatcaggctgtagcccccgttcctcctgcgccagctgctactgatgtagcagca
tcgagcgcaggcccggtcgaggtacacgtgcctgacattggtgacttcaaggatgtgacg
gtgattgaggtcatggtcaaggtgggcgacgctgtccggcttgagcaaagcctgattacc
gtggagtctgataaagcatccatggaaatcccgtccagcgcggcgggcgtgatcaaggag
ctcaaggtcaaactgggcgacaaagtcaatattggcgacctgctggcgattctggaaggc
gccgcgccggttgctatggctgcagctgcaactgcgcaggcttcagcggcagccgctgca
ccgctggtctcggctgcggctgctgttgcaccagcaactgccgtgctggccgtgcccgcg
cacatccccacatcggccccgctgggtctgccccacgcctcgccgtcggtgcgcaagttt
gcccgcgagttgggcgtgcccctggatgaggtcaaaggcacgggtctcaaaggtcgcatc
accgacaacgacgtgcaagccttcacccgctcggtgatgagcggcgcgattcaaacgctg
gctgctcaggcacagcccaaggcagccgcagccgctccaggcgctgacggcgcaggcctg
ggcctgatcccgtggccgaaagtggactttgccaagtttgggccggtcgagcgcaaggaa
ctcagccgcatcaagaaaatcagcggtgccaacctgctgcgcaacgcgatcctgattccg
gccgtgaccaaccatgacgactgtgacatcaccgacctggaagccttccgggtctcgacc
aacaaagagaacgagaagagtggcgtgaaggtcaccatgctggcgttcctgatcaaggcc
tgcgtggccgcgctcaagaaataccccgagttcaacagctcgctggacggcgacgcgctg
atctacaagcagtactaccacatcggttttgcggcggacacgcccaacggcctgatggtg
ccggtgatcaaggatgctgatcaaaaaggcatcatgcaaatctcggtcgagatgggcgaa
ctggccaaaaaggcgcgcgatggcaagttgagcccggccgagatgaccggcgccagcttc
accatcagcagcctgggcggcattggcgggcgttatttcacgcccatcatcaacgcgcct
gaagtgtcgattctgggcgtgtgccgctccaccatccagccggtgtgggatggcaaggcg
ttccagccacgcctgatgctgccgctgtcacttacctgggaccaccgcgtgattgacggt
gccgctgcggcccgcttcaatgtctatctgggccaaatcctgggcgatttccgccgggtg
ttgctttag

DBGET integrated database retrieval system