KEGG   Rhodoferax ferrireducens: Rfer_2241Help
Entry
Rfer_2241         CDS       T00334                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rfer_2241
Enzymes [BR:rfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Rfer_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2453978..2455546)
Genome map
AA seq 522 aa AA seqDB search
MRKHTDKPQLASKLVLRRVAIDTYRENVAYLHRDCAVYRAEGFQALSKVEVRANGRHILA
TLNVVDDPNIVACNELGLSEDAFAQMAVIDGQPASVSQAEPPQSIGALRRKLAGERLGRE
DFLGIVRDIAELHYSKIELSAFVVATNRDELDREEVYFLTEAMVASGRTLNWHEPLVVDK
HCIGGIPGNRSSMLVVPIVAAHGLLCPKTSSRAITSPAGTADTMEVLAKVELPVDQLADI
VRTHRGCLAWGGAAHLSPADDVLISVERPLAIDSPGQMVASILSKKIAAGSTHLVLDIPI
GPSAKVRSMPEAQRLRRLFEYVAGRMHLSLDVVVTDGRQPIGNGIGPVLEARDVMRVLEN
DPRAPNDLRQKSLRLAGRLIEFDPDVRGGDGFAIARDILDSGRALAKMNAIIAAQGAKPF
DHNHPQLGALTFDICASESGVVTGIDNLQVARIARLAGAPKVIGAGIDLFHKLGEAVTSG
EVLYRVHAGFQSDLDFARQACAKSTGYTLGRAEDVPHVFTEF
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaacacaccgacaaaccgcagttggccagcaagctggtgctgcgccgggtggcg
atcgacacctaccgtgaaaacgtggcctacctgcaccgggactgcgcggtataccgggct
gaaggcttccaggccctgtccaaagtcgaggtccgggccaacggacgccacattctggcc
accctgaacgtggtggatgaccccaatatcgtcgcctgcaatgagctcggcctgtcagaa
gacgcttttgctcagatggcggtgattgatggtcagccagcctcggtgtctcaggccgaa
ccgccgcagtccattggcgcgctgcgccgcaaattggccggcgaacggctcggccgtgag
gactttctgggtatcgtgcgcgacattgccgaactgcactattccaaaattgaactgagt
gcttttgttgtggccaccaaccgggatgaactggaccgcgaagaggtctactttttgacc
gaggcgatggtggccagtggtcgaacgctcaactggcatgaacccctggtggtggacaaa
cactgtattggtggcattcccggcaaccgcagctctatgctggtggtgccgattgtggcg
gcgcacggcctgctgtgccccaaaacatcatcgcgcgccatcacctccccggccggtacg
gccgacacgatggaagtgctggccaaggtggagctgcctgttgatcagctggcggacatc
gtgcgcacgcatcggggctgcctggcctggggcggcgccgcccatttgtcgccggccgac
gatgtgctgatttcggtcgagcgaccgctggcgattgactcgccagggcaaatggtggcc
tccattctgtccaagaagattgccgcggggtccacccatctggtccttgatattcccatc
ggccccagcgccaaagtacgctccatgcccgaggcccaacgtctgcgccggctttttgag
tacgtggcggggcgcatgcatttgtcgctcgacgtggtcgtgaccgatggacgccaaccc
atcggcaatggcatcggaccggtgcttgaggcgcgcgatgtgatgcgggtgctggagaat
gacccccgggcacccaacgacctgcgacaaaaatccttgcgactggctggccgactgatt
gaattcgacccggatgtgcgcggtggcgacggttttgccattgcgcgggacattctggat
tctggccgggcactggcgaaaatgaacgccattattgccgcccagggcgctaagccgttt
gatcacaaccatccgcaactcggcgccttgacctttgacatttgcgccagcgagtccggt
gtggtcaccggcattgacaacctgcaggtggcgcgcatcgcccgcttggcgggtgcaccc
aaagtcatcggcgccggcattgatctttttcacaaattgggggaggcggtgaccagtggc
gaggtcttgtaccgcgttcacgccgggtttcaaagcgacctcgactttgcgcgccaagcc
tgcgccaagtcgaccggctataccctcgggcgagccgaagatgtaccccatgtctttacg
gaattctga

DBGET integrated database retrieval system