KEGG   Rhodoferax ferrireducens: Rfer_2244Help
Entry
Rfer_2244         CDS       T00334                                 

Gene name
uvrC
Definition
excinuclease ABC subunit C
Orthology
K03703  
excinuclease ABC subunit C
Organism
rfr  Rhodoferax ferrireducens
Pathway
Nucleotide excision repair
Class
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:rfr03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2457472..2459487
Genome map
AA seq 671 aa AA seqDB search
MPHLPDSMSPEAPAGPAPATLPAHPAQLLSDVAGLPPLPGVYRYFDFDGAVLYVGKAINL
KKRVSSYFQKNHGGTRIGHMVSKIVRLETTVVRSEAEALLLENNLIKTLNPKYNILFRDD
KSYPYLKMTGASSSSNPGTSFPRVSYYRGAVEKKHQYFGPYPSAWAVKEAILLMQKVFHL
RTCEDPVFNNRTRPCLLYQIKRCSAPCVGHISAADYAQDVANAERFLRGDARQVMEALEA
RMMAHAEKLEFEQAAELRNQVAALSNVLHQQSVDNVADRDVDILAVKVQGGRACVNLAMV
RGGRHLGDRPYFPAHVEDATEIYNAGGFEEAVEDSTTAPPVPSVETQVLEAFVAQHYLNV
PVPPTLIVSAPVNKQLLEALAIQSGVKVTAVHQPREQRRVWLEMAQTNAGLQLARLLSEE
GSQQARTRALAEALDLALDDLDALRVECFDISHTAGEATQASCVVFAHHKMQNAEYRRYN
INDITPGDDYAAMRQVLLRRYGKLAETLREAQQTGQMPAGTGRLPDLVLVDGGRGQVSMA
REVFEQLGLDLSLIVGVEKGEGRKVGLEELVFADGREKVYLGKDSAALMLVAQIRDEAHR
FAITGMRAKRAKVRVDGGKLEEIPGIGPKRRSKLLQRFGGVRGVALAGAEDIATVAGISR
ELAEEIYRALH
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatttgcctgattccatgtcacctgaagcgcccgcaggcccggcgcccgcaacc
ctgcccgcgcaccctgcgcagttgctcagcgacgtggcgggtttgccgcccctgccgggc
gtgtaccgctatttcgactttgatggcgctgtgctctacgtgggcaaggccatcaatttg
aaaaagcgggtgtcgagctattttcagaaaaatcacggcggcacgcgtatcggccacatg
gtgagcaagatcgtgcggctggaaacgacggtggtgcgctcggaggccgaggcgctgctg
ctggaaaacaacctgatcaagacgctcaaccccaagtacaacattttgtttcgggatgac
aagagttatccgtacttgaagatgacaggcgcgagttcttcttcgaatccgggcaccagc
tttccacgggtgtcctactaccggggcgcggtggagaaaaagcatcagtatttcggacct
tatccgagcgcctgggcggtcaaggaagcgattttgctgatgcagaaggtgtttcatctg
cgcacctgtgaagacccggtattcaacaaccgcacgcgcccgtgtctgctgtaccagatc
aaacgttgttcagcaccttgcgtcggccacatttctgccgcggactatgcgcaggacgtc
gccaacgccgagcgttttttgcgtggcgatgcgcgtcaagtcatggaggcgctggaggct
cgcatgatggcgcatgctgaaaagctggagttcgagcaggcggccgaactgcgcaatcag
gtggcggcgctgtccaacgtgctgcatcaacagtcggtggacaacgtggcggatcgcgat
gtggacatcctggcggtgaaggtgcagggtggccgtgcgtgcgtcaatctggcgatggtg
cgcggcgggcgccatctcggggatcggccgtattttccggcgcacgtggaagacgcaacc
gagatttacaacgccggaggttttgaagaagcggtggaggacagcacgacagcgccccct
gtacccagtgttgaaacccaggtgctggaagcctttgtggcacagcattatctgaacgtg
cccgtgcccccgacactgattgtcagtgcgccggtgaacaaacaactgctcgaagcgctc
gctatccagtccggcgtcaaggtcacggcggtgcaccaaccgcgcgagcagcgccgtgtc
tggctggaaatggcgcaaaccaatgccgggctgcagttggcccgcctgctctccgaggaa
ggctcgcaacaggcgcgcacccgggcgttggccgaggcgctggatctggcgctggacgat
ctggacgcgctgcgggtcgagtgttttgatatatcccatacggcaggtgaggccacccaa
gcctcttgtgtggtgtttgcgcaccacaaaatgcagaacgccgagtaccgacgttacaac
atcaacgacatcacaccaggcgacgattacgcggccatgcgccaggtgttgctgcgtcgc
tatggcaagctggccgagaccttgcgcgaggcgcaacagaccggtcaaatgcctgcgggc
accggccgactgccggacttggtcctggtggacggcggcagaggccaggtcagcatggcg
cgcgaggtatttgagcaattgggcctggacttgtcgctgatcgtcggcgttgagaaaggc
gaggggcgcaaggtcgggctggaagaactggtgtttgccgatggccgcgagaaagtctac
ctgggcaaagactcggccgcgctgatgctggtggcgcagattcgcgacgaggcgcatcgt
tttgccattaccggcatgcgtgccaaacgcgccaaggtgcgggtggatggcggcaagctc
gaagaaatcccaggcattggccccaagcgccgatccaaattgttgcagcgctttggtggt
gtgcgtggcgtggcgctggcgggggcggaggatattgcgacggtggcgggaatctcgcgc
gagttggcggaagaaatttaccgcgccctgcactga

DBGET integrated database retrieval system