KEGG   Rhodoferax ferrireducens: Rfer_2320Help
Entry
Rfer_2320         CDS       T00334                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00020  Citrate cycle (TCA cycle)
rfr00310  Lysine degradation
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
Module
rfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rfer_2320
  Amino acid metabolism
   00310 Lysine degradation
    Rfer_2320
Enzymes [BR:rfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rfer_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PRO8NT
Motif
Other DBs
NCBI-ProteinID: ABD70038
JGI: Rfer2320
UniProt: Q21W15
Position
complement(2544880..2546142)
Genome map
AA seq 420 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLQWKKKVGDAVAVDEILIDIETDKVVLEVPAPSAGVIVEI
LVADGGTVAAEQVIARIDTEAKAGAAVAPAAAQAAVAAPVATASAAVVGGGAMAGVPMPA
AAKLMADNQLAAGSVAGTGKDGRVTKGDVLSAVAAASAPKAAAVAAMPARAVATLLPQVA
APAVNLGERPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEINMAPVMDMRKRMQERFE
KEHGVKLGFMSFFVKAAVHALKKFPMLNASVDGTDIVYHGFFDIGIAVGSPRGLVVPILR
NADQMSFADIEKKIAEYGAKARDGKLGMEEMTGGTFSISNGGTFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGQVVVRPMNYFAMSYDHRIIDGREAVLGLVAMKEALEDPARLLFDI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtgaaagtcccgcaactgtcggaatccgtggctgaggccaccatg
ttgcagtggaagaagaaggtcggtgacgctgtcgccgtggatgaaatcctgatcgacatc
gaaaccgacaaagtggtgctggaagttcccgccccgtcggctggtgtgattgttgagatt
ctggtcgctgacggtggcaccgtggcggccgagcaggtgattgcccgcatcgacaccgaa
gccaaggctggtgcggcggttgcgcctgcggcggctcaagctgccgtggccgcgccagtc
gccacggcgtcggcagcagtggtgggcggcggtgcgatggccggtgtgccgatgccagcg
gcggccaagctgatggcggataaccagctggccgcaggctccgtggcaggcacaggtaaa
gatggccgcgtcaccaagggtgatgtgttgagcgctgttgcggctgcttctgcgcctaaa
gcagcagccgttgccgcaatgccagcaagggctgtagcgactttactgcctcaggtcgca
gcaccggctgtcaatctgggcgaacgcccggagcagcgcgtgcccatgagtcgcctgcgc
gcccgtgtcgccgagcggctattgcaatcgcaatccaccaatgccattttgaccacgttc
aacgagatcaacatggcgccggtgatggacatgcgcaagcgcatgcaggagcggtttgag
aaagagcatggcgtgaagctgggcttcatgagtttcttcgtcaaggcggcggtgcatgcc
ctcaagaagttcccgatgctcaatgcgtcggtggatggcaccgacatcgtctatcacggc
ttttttgatattggtatcgctgtgggctcaccgcgcggtttggtagtgccgattttgcgc
aatgccgaccagatgagctttgccgacattgagaagaagatcgccgaatacggtgccaaa
gcccgtgacggcaagctgggcatggaagaaatgaccggtggcacgttctcgatcagcaat
ggtggcacctttggctccatgctgtccactcccatcatcaatccgccgcagtcggccatt
ttgggggttcacgcgaccaaagaccgcgccgtggtggaaaacggtcaagtggtggtgcgc
cccatgaactacttcgccatgagctacgaccaccgcatcatcgacggccgcgaagccgtg
ctgggcctggtggcgatgaaggaagcgctggaagacccggcgcgcctgttgttcgacatc
taa

DBGET integrated database retrieval system