KEGG   Rhodoferax ferrireducens: Rfer_2320Help
Entry
Rfer_2320         CDS       T00334                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rfer_2320
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rfer_2320
  Amino acid metabolism
   00310 Lysine degradation
    Rfer_2320
Enzymes [BR:rfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rfer_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2544880..2546142)
Genome map
AA seq 420 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLQWKKKVGDAVAVDEILIDIETDKVVLEVPAPSAGVIVEI
LVADGGTVAAEQVIARIDTEAKAGAAVAPAAAQAAVAAPVATASAAVVGGGAMAGVPMPA
AAKLMADNQLAAGSVAGTGKDGRVTKGDVLSAVAAASAPKAAAVAAMPARAVATLLPQVA
APAVNLGERPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEINMAPVMDMRKRMQERFE
KEHGVKLGFMSFFVKAAVHALKKFPMLNASVDGTDIVYHGFFDIGIAVGSPRGLVVPILR
NADQMSFADIEKKIAEYGAKARDGKLGMEEMTGGTFSISNGGTFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGQVVVRPMNYFAMSYDHRIIDGREAVLGLVAMKEALEDPARLLFDI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtgaaagtcccgcaactgtcggaatccgtggctgaggccaccatg
ttgcagtggaagaagaaggtcggtgacgctgtcgccgtggatgaaatcctgatcgacatc
gaaaccgacaaagtggtgctggaagttcccgccccgtcggctggtgtgattgttgagatt
ctggtcgctgacggtggcaccgtggcggccgagcaggtgattgcccgcatcgacaccgaa
gccaaggctggtgcggcggttgcgcctgcggcggctcaagctgccgtggccgcgccagtc
gccacggcgtcggcagcagtggtgggcggcggtgcgatggccggtgtgccgatgccagcg
gcggccaagctgatggcggataaccagctggccgcaggctccgtggcaggcacaggtaaa
gatggccgcgtcaccaagggtgatgtgttgagcgctgttgcggctgcttctgcgcctaaa
gcagcagccgttgccgcaatgccagcaagggctgtagcgactttactgcctcaggtcgca
gcaccggctgtcaatctgggcgaacgcccggagcagcgcgtgcccatgagtcgcctgcgc
gcccgtgtcgccgagcggctattgcaatcgcaatccaccaatgccattttgaccacgttc
aacgagatcaacatggcgccggtgatggacatgcgcaagcgcatgcaggagcggtttgag
aaagagcatggcgtgaagctgggcttcatgagtttcttcgtcaaggcggcggtgcatgcc
ctcaagaagttcccgatgctcaatgcgtcggtggatggcaccgacatcgtctatcacggc
ttttttgatattggtatcgctgtgggctcaccgcgcggtttggtagtgccgattttgcgc
aatgccgaccagatgagctttgccgacattgagaagaagatcgccgaatacggtgccaaa
gcccgtgacggcaagctgggcatggaagaaatgaccggtggcacgttctcgatcagcaat
ggtggcacctttggctccatgctgtccactcccatcatcaatccgccgcagtcggccatt
ttgggggttcacgcgaccaaagaccgcgccgtggtggaaaacggtcaagtggtggtgcgc
cccatgaactacttcgccatgagctacgaccaccgcatcatcgacggccgcgaagccgtg
ctgggcctggtggcgatgaaggaagcgctggaagacccggcgcgcctgttgttcgacatc
taa

DBGET integrated database retrieval system