KEGG   Rhodoferax ferrireducens: Rfer_2424Help
Entry
Rfer_2424         CDS       T00334                                 

Definition
lipolytic enzyme, G-D-S-L
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rfer_2424
Enzymes [BR:rfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rfer_2424
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rfer_2424
Lipid biosynthesis proteins [BR:rfr01004]
 Fatty acid synthase
  Component type
   Rfer_2424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2674009..2674545)
Genome map
AA seq 178 aa AA seqDB search
MLGDSLSAEYGLKRGSGWVALLEQQLKAEKIPASVINASISGDTTSGGRARLGSLLTQHR
PTHVLIELGGNDALRGLPLELTQDNLTFMTQAAQQAGAKVLLIGMQIPPNYGKDYGERFA
AMFASVAKARRAALVPFLLKGIAEDDATRLFQADRIHPKEEAHPLMLANVWPELKKIL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgttgggcgattcgctgagtgccgagtatggcctcaaacgcggcagcggctgggtggcg
ctgcttgagcagcaactcaaggccgaaaagattccggccagcgtgatcaacgccagtatc
agcggcgacaccacatccggcggacgcgcgcggctggggtcgctgctgacccagcaccgg
ccgacccatgtgctgattgaactcggtggcaatgacgcactgcgtggcttgccgctggaa
ctcacccaggataacctgacgttcatgacgcaggcggcgcaacaggccggcgccaaagtg
ctgctgatcggcatgcagattccacccaactatggcaaagactatggcgaacgttttgcc
gcgatgtttgccagcgtggcaaaagccaggcgcgccgcgttggtgccgttcttgctcaaa
ggtattgccgaagatgacgcgacccgcttgtttcaggccgaccgcatccaccccaaggaa
gaggcccaccctctcatgctggccaatgtgtggccggaattgaaaaagatcctgtaa

DBGET integrated database retrieval system