KEGG   Rhodoferax ferrireducens: Rfer_2698Help
Entry
Rfer_2698         CDS       T00334                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rfer_2698
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rfer_2698
   00620 Pyruvate metabolism
    Rfer_2698
   00640 Propanoate metabolism
    Rfer_2698
  Energy metabolism
   00680 Methane metabolism
    Rfer_2698
Enzymes [BR:rfr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rfer_2698
Lipid biosynthesis proteins [BR:rfr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rfer_2698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2967759..2969570)
Genome map
AA seq 603 aa AA seqDB search
MRVSQASDKSPASPPQAYTRLHSHFRWQVPEQFNIAQVCCARWAAQPDATKKVAICAYET
GASGQFYTYSELQAQANRLSNVLTALGVGRGDRVAIVMPQCFETAVAYVAVLQMGAVAMP
LSMLFGPQALEFRLHDGEAVVAIGAASALEGLQAVRANCPVLHYVLGVGDLEATDQRADL
NYALALAQEDAHFTPVATLAEEAAVLIYTSGTTGNPKGALIPHRALIGNLTGFVCSQNWF
GFDPAANPASAGLGDLPVGSDAVFWSPADWAWTGGLMDALLPTLYFGRTIVAYNGRFSPQ
TALELMRDCHVTHTFLFPTALKAMMKAYPGSARHTVRQQFKLQLQAIMSAGEAVGDAVFD
YCQQQLGVTVNEMFGQTEINYIVGNCSAQWPPKPGSMGMGYPGHRVAVIDDAGAECPVGV
AGDVALNRFDRHGDADPIFFLGYWKNESSTRAKFTGDWCRTGDLALRDADGYLWYQGRAD
DVFKAAGYRIGPGEIENCLVKHPAVANAAVVPKPDPARGSVVKAYVVLAPDFIAARPLDT
VARAEFDLKLVAQLQAHVKGMLAPYEYPKEIEFIDALPMTSTGKVQRRVLRLQEEQRAQQ
RAG
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcagtcaagccagcgacaaatcaccggcctcaccaccgcaggcctatacccgg
ctgcacagccacttcaggtggcaggtgcccgagcagttcaacatcgcccaggtttgttgt
gcgcgctgggcggcgcagccagacgctaccaaaaaagtagctatttgcgcttacgagacg
ggggctagcggccagttttatacttattctgaactgcaggcgcaggccaaccgcttgtcc
aacgtgctcacggcattgggggtagggcggggcgaccgggtcgcgattgtgatgccgcag
tgcttcgagaccgccgtggcctacgtggcggtgctgcaaatgggcgcggtggcgatgccg
ttgtcgatgctgtttggcccgcaggcgctggagtttcgcctgcatgacggcgaagccgtg
gtggccattggcgccgccagcgcgctggaaggcttgcaggcggtgcgagccaactgcccg
gtgctgcactacgtgctgggcgtgggcgatctggaggccaccgaccagcgagccgacctc
aattacgcgctggcgctggcgcaggaggacgcgcacttcacgccggtcgccacgctggcc
gaggaggccgccgtgttgatctacaccagcggcaccaccggcaaccccaagggggcgctg
atcccccaccgcgccctgatcgggaacctgaccggttttgtctgcagccaaaactggttt
ggttttgatcccgccgccaacccggccagcgcggggctaggcgatttgcccgtgggctcg
gacgccgtcttctggagcccggccgactgggcctggaccggcggcctgatggatgccctt
ttgcccacgctttactttggccgcacgatcgtggcgtacaacggccgcttcagcccgcaa
acggcgctggagctgatgcgcgactgccatgtgacgcacacgtttttgtttccgaccgca
ctcaaggccatgatgaaggcttatccgggcagcgcgcgccacaccgtgcgccagcagttc
aagctacaactgcaagccatcatgagcgcgggcgaggcggtgggtgacgcggtatttgac
tattgccagcagcaattgggtgtgacggtcaacgagatgtttggccagaccgagatcaac
tacatcgtcggcaattgttctgcccaatggccgcccaagcctggcagcatgggcatgggc
taccccggtcatcgggtggcggtgatagacgatgcgggcgccgagtgcccggtgggtgtg
gccggtgacgtggctttgaaccggtttgaccggcacggtgatgcggacccgattttcttt
ttgggctactggaaaaacgagagttcaacccgtgccaaattcaccggcgactggtgccgc
accggcgatctggcgctgcgtgacgccgacggttacctgtggtaccagggccgtgccgat
gacgtgttcaaggccgccggttaccgcatcggccccggcgagatcgagaactgcctggtc
aagcatccggcggtggccaacgccgccgtggtgcccaagccggacccggcacgcggttca
gtggtcaaggcctatgtcgtgctggctcctgattttatagctgctcgccctttggatacg
gtggctagggccgagtttgatctaaaactcgtggcacagctgcaagcccacgtcaaaggc
atgctggcgccgtacgagtacccgaaagagattgaattcatcgatgccctgcccatgacc
agcaccggcaaggtgcagcggcgggtgttgcggctgcaggaggagcagcgcgcccaacaa
cgggcgggctga

DBGET integrated database retrieval system