KEGG   Rhodoferax ferrireducens: Rfer_2781Help
Entry
Rfer_2781         CDS       T00334                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rfr  Rhodoferax ferrireducens
Brite
Enzymes [BR:rfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rfer_2781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3068556..3069350)
Genome map
AA seq 264 aa AA seqDB search
MKERPPFPVRLDFSAGKPTDRRSVPRFAGQAQSPGARPSGHPLSQGVGMDSSAVRMNMVR
KLVQQGVSDPMVLAAMQAIERHRFVDTALVNQAYEDTSLPIGLGQTISKPGVVARMLELL
RNGAPGKLGRVLEIGTGCGYQAAVLSRLASEVYSIERLRGLHDKARHNLRHLALANLHLL
FGDGMVGYVKGAPYAAIIAAAGGEAVPQAWIDQLAMGGRLVAPVSAGAGAPGRQALVVID
RTPQGLRQMMLEAVHFVPLKSGIA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcgcccgccttttcctgtccggctggatttctcggcgggtaaacccacagac
aggcggtccgtcccgaggtttgcaggacaggcccagagcccgggcgccaggccgtcaggc
cacccgctttcccaaggcgtggggatggactccagcgcggtgcgcatgaacatggtgcgc
aagctcgtccagcaaggtgtcagcgaccccatggtgctggcggccatgcaggccattgaa
cgccaccgttttgtcgacacggcgctggttaatcaggcctatgaggacacgagtctgccg
attggcctgggacagaccatctccaaacctggtgtggtggcccgtatgctggaactgctg
cgcaacggcgcgccgggcaaattgggacgtgtgctggagatcggaacgggctgcggctat
caagcggcagtgttgagccggttggcgagcgaggtctacagcatcgaacgactgcgcggt
ttgcatgacaaggcacgtcacaacctgcggcatttggcgctggccaacctgcatcttttg
tttggggatggtatggtgggctatgtcaagggcgccccctacgcggccatcatcgctgct
gccgggggggaagccgtgccccaggcctggatcgatcaactggccatgggcgggcgattg
gtggcgccggtgtccgccggcgctggggcgccagggcggcaagcgctggtggtgattgat
cgtacgccgcaaggtctgcggcaaatgatgcttgaggcggttcactttgtccctttaaaa
tcggggatcgcatga

DBGET integrated database retrieval system