KEGG   Rhodoferax ferrireducens: Rfer_3182Help
Entry
Rfer_3182         CDS       T00334                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr01040  Biosynthesis of unsaturated fatty acids
rfr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rfer_3182
Enzymes [BR:rfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Rfer_3182
Lipid biosynthesis proteins [BR:rfr01004]
 Desaturase
  First
   Rfer_3182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: ABD70891
JGI: Rfer3182
UniProt: Q21TL2
Position
complement(3518993..3520207)
Genome map
AA seq 404 aa AA seqDB search
MLLPDWAALDTLLDWLAHGFWPLSWWQMVLFTLVMTHVTMISVTVFLHRHQAHRALDLHP
VAAHFFRFWLWLTTGQVTKEWTSIHRKHHAKCEQAEDPHSPHVYGIKTVLLQGYELYRKE
AANKETMTRYGHGTPNDWLERNLYSRFSWQGVSLMLVIDLVLFGAAGLVVWAVQMAWTPV
MAAGIVNGAAHYWGYRNFEVTDASTNISPWGILIAGEELHNNHHTYPTSAKLSVKPYEFD
IGWVYISLMQRLGLATVKKTPPKLALGDIRPVADEKTLEALISNRYEIMAAYAKDMRRAF
KDELQALQARRADAAVIKAAKRWLHRDVDKVPAAAVPQLALARAASPVLDKMVLMREELR
QMWLNRSHTREQLAADLQAWCHQAEASGIVALQAFSLRLRAAQA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttgttacctgactgggctgccctggatactctgcttgactggctggcgcatggattt
tggccgctgagctggtggcaaatggtgttgttcactttggtcatgacgcacgtcaccatg
atcagcgtgacggtgttcttgcatcggcatcaggcgcaccgcgcgcttgatttgcacccg
gtggccgcccactttttcagattctggttgtggctgaccacgggccaggtcaccaaagag
tggacctccattcaccgcaagcaccatgccaagtgcgagcaggccgaagacccgcacagt
ccgcatgtctacggcatcaaaaccgtgctgctgcaaggttatgagttgtaccgcaaagag
gccgccaacaaggaaaccatgacgcgttatggtcatggcacgcccaatgactggctggag
cgcaatctgtacagccgtttttcctggcagggtgtgagcttgatgctggtcattgatctg
gtcttgtttggcgccgcgggcctggtcgtgtgggcggtgcagatggcctggaccccggtg
atggccgccggcatcgtgaatggtgcggcgcattattggggttaccgcaattttgaggtg
accgatgccagcaccaacatttcaccctggggcatcctgattgccggtgaagagctgcac
aacaaccaccatacctaccccacctcggccaagctgtcggtcaagccctacgagtttgat
attggctgggtgtacatcagcctgatgcagcgccttggcttggccaccgtcaagaagacg
cccccgaaactggcgctgggtgacatacgcccggtagcggatgaaaaaaccctggaggcg
ctgatctccaaccgttatgaaatcatggccgcttacgccaaagacatgcgtcgtgccttc
aaggatgagttgcaggccctgcaggcgcgccgcgctgacgctgcggtcatcaaagcggcc
aagcgctggctgcaccgtgatgtggacaaagtaccggcggctgccgtgccccagttggcc
ttggcccgggcggcttcgccggtgctcgacaaaatggtgctgatgcgcgaagagttgcgc
cagatgtggctgaatcgctcccatacccgcgagcaattggcggctgatttgcaagcctgg
tgccaccaggccgaggccagcggcattgtggctttgcaggcgttctcattgcggctgcgg
gcggcgcaggcctga

DBGET integrated database retrieval system