KEGG   Rhodoferax ferrireducens: Rfer_3182Help
Entry
Rfer_3182         CDS       T00334                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rfr01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rfr01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3518993..3520207)
Genome map
AA seq 404 aa AA seqDB search
MLLPDWAALDTLLDWLAHGFWPLSWWQMVLFTLVMTHVTMISVTVFLHRHQAHRALDLHP
VAAHFFRFWLWLTTGQVTKEWTSIHRKHHAKCEQAEDPHSPHVYGIKTVLLQGYELYRKE
AANKETMTRYGHGTPNDWLERNLYSRFSWQGVSLMLVIDLVLFGAAGLVVWAVQMAWTPV
MAAGIVNGAAHYWGYRNFEVTDASTNISPWGILIAGEELHNNHHTYPTSAKLSVKPYEFD
IGWVYISLMQRLGLATVKKTPPKLALGDIRPVADEKTLEALISNRYEIMAAYAKDMRRAF
KDELQALQARRADAAVIKAAKRWLHRDVDKVPAAAVPQLALARAASPVLDKMVLMREELR
QMWLNRSHTREQLAADLQAWCHQAEASGIVALQAFSLRLRAAQA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttgttacctgactgggctgccctggatactctgcttgactggctggcgcatggattt
tggccgctgagctggtggcaaatggtgttgttcactttggtcatgacgcacgtcaccatg
atcagcgtgacggtgttcttgcatcggcatcaggcgcaccgcgcgcttgatttgcacccg
gtggccgcccactttttcagattctggttgtggctgaccacgggccaggtcaccaaagag
tggacctccattcaccgcaagcaccatgccaagtgcgagcaggccgaagacccgcacagt
ccgcatgtctacggcatcaaaaccgtgctgctgcaaggttatgagttgtaccgcaaagag
gccgccaacaaggaaaccatgacgcgttatggtcatggcacgcccaatgactggctggag
cgcaatctgtacagccgtttttcctggcagggtgtgagcttgatgctggtcattgatctg
gtcttgtttggcgccgcgggcctggtcgtgtgggcggtgcagatggcctggaccccggtg
atggccgccggcatcgtgaatggtgcggcgcattattggggttaccgcaattttgaggtg
accgatgccagcaccaacatttcaccctggggcatcctgattgccggtgaagagctgcac
aacaaccaccatacctaccccacctcggccaagctgtcggtcaagccctacgagtttgat
attggctgggtgtacatcagcctgatgcagcgccttggcttggccaccgtcaagaagacg
cccccgaaactggcgctgggtgacatacgcccggtagcggatgaaaaaaccctggaggcg
ctgatctccaaccgttatgaaatcatggccgcttacgccaaagacatgcgtcgtgccttc
aaggatgagttgcaggccctgcaggcgcgccgcgctgacgctgcggtcatcaaagcggcc
aagcgctggctgcaccgtgatgtggacaaagtaccggcggctgccgtgccccagttggcc
ttggcccgggcggcttcgccggtgctcgacaaaatggtgctgatgcgcgaagagttgcgc
cagatgtggctgaatcgctcccatacccgcgagcaattggcggctgatttgcaagcctgg
tgccaccaggccgaggccagcggcattgtggctttgcaggcgttctcattgcggctgcgg
gcggcgcaggcctga

DBGET integrated database retrieval system