KEGG   Rhodoferax ferrireducens: Rfer_3199Help
Entry
Rfer_3199         CDS       T00334                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:rfr00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3540918..3542870
Genome map
AA seq 650 aa AA seqDB search
MNTPNNKIAIPRDLGRRNFLNKTAIAGLAGAGLSAGLVACNKTAGPAATGSPAVAASEPA
KSGAVDYSAYEVHPGQLDTYYSFSSGGHSGEVRIYGLPSGRLFKRIPVFNIDCLVGWGIT
NESKKIMGTNADGSLKYFTGDTHHVHPSYTDGTYNGKHLFVNDKIHGRIARVRLDTMECD
KITELPNVQGFHGIFPDKRDPVDEKINYTTRVFCGNEFHIPQPNDGRDLNDPTKYFCLFT
CIDAETLEPRWQVKVDGNMDLVATSYDGKLACSNQYNMENGAHYEDMMSLERDSCIFFNI
ARIEAAVKAGKTFFIGKSKVPVVDGTKSANADPKTALTCYVPTPKNPHGVNASPDGKYYA
CSGKLSPTATLIEHALVLKWFDGELKEPRDTVVAEPEIGLGPLHTGFDNKGNAYTTLFLD
SQIVKWNLEAAIKSFKGDKAAKPVVDRIDVQYQPGHGFTSMGETKNADGKFFLSDNKFSK
DRFLPVGPLHPETAQLIDISGDKMKLVADHSVYSEPHDSIIIPRELIRTRQVYDINEFPN
AVKDAKECRVERKGKKVTVYLTSQAPTFGLREWTVKKGDEVTIILTNLDKVEDLTHGFAI
PNYNINFIVNPQETKSVTFKADKPGVYWCYCTNFCHALHLEMRSRMLVEA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcccaacaataaaatcgcgatccccagggatctgggtcgtcgcaattttctc
aacaaaacggcaattgccggccttgccggggctggcttgtcggccggcctggtggcctgc
aacaagacggccggtccggctgcgaccggcagcccggctgtagcggcttcggagccggcc
aagagtggtgctgtcgattactcagcctacgaggtgcatcccggccaactcgatacttac
tactccttttcttccggcggtcactcgggcgaagttcgtatctatggcttgccctcgggc
cgcttgttcaagcgcattccggtgttcaacattgactgtctcgtcggctggggtatcacc
aacgaatcgaagaagatcatgggcaccaacgcggacggcagtctgaaatacttcacgggt
gacacccatcatgtgcatccgtcctacaccgacggaacctacaacggcaaacaccttttc
gtcaatgacaaaatccatggtcgcatcgcgcgcgtgcggctcgataccatggagtgcgac
aagatcaccgaattgcccaacgtccagggtttccacgggattttcccggacaagcgcgat
ccggttgacgaaaagatcaactacacaacccgcgttttttgtggcaacgagttccacatt
ccccagcccaacgacggccgcgacctcaacgacccgaccaagtatttctgcctgttcacg
tgtatcgatgcggaaaccctggagccgcgctggcaggtcaaggtagacggcaacatggat
ttggtggcgacctcctacgacggcaaactggcatgttccaatcaatacaacatggagaat
ggcgcccattatgaggacatgatgtcgcttgagcgcgactcctgcatcttcttcaacatt
gcccgcatcgaggcagctgtcaaggccggaaaaacatttttcatcggcaaatccaaggtt
ccggtggtggacggcaccaaatccgccaacgcagacccgaagaccgcgctgacctgctat
gtgccgacaccaaagaacccgcacggcgtcaacgccagcccggacggcaagtactacgcc
tgctccggcaagctctcgccgacggccaccctgattgagcatgctttggtactgaaatgg
ttcgacggtgagctcaaggagccgcgcgacaccgtggtcgccgaacctgaaatcggtctg
ggcccactgcacaccggtttcgacaacaagggcaacgcctatacgacgctcttcctggac
agccagatcgtcaaatggaacctcgaggccgccatcaaatccttcaagggtgataaagcg
gcaaagccggtggtggaccgcatcgacgtccaataccagccaggccacggttttacgtcc
atgggcgagaccaagaatgccgacggcaagttcttcctgtccgacaacaagttctccaag
gaccgcttcctgccggttggaccgctgcacccggaaaccgcgcaactgattgacatcagc
ggcgacaagatgaagctcgtggccgaccactcggtgtactccgagccgcatgactccatc
atcattccacgcgagctgatcaggacccggcaggtctatgacatcaacgagttccccaac
gcggtcaaggatgccaaggaatgtcgtgtcgaacgcaaaggcaagaaggtgacggtctac
ctgacatctcaggcgccaaccttcggactgcgcgagtggacggtcaaaaagggcgatgag
gtcaccatcatcctcaccaacctggacaaggtagaggatctgacccatggctttgccatc
ccgaactacaacatcaactttattgtcaacccccaggagaccaaatcagtcaccttcaag
gccgacaagcccggtgtctattggtgctactgcaccaacttctgccatgcactgcacctt
gagatgcgttcgcgcatgctggtggaagcctga

DBGET integrated database retrieval system