KEGG   Rhodoferax ferrireducens: Rfer_3285Help
Entry
Rfer_3285         CDS       T00334                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rfr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rfr00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3647360..3648142
Genome map
AA seq 260 aa AA seqDB search
MLKGHTALVTGSTQGIGLAIAHALARAGANVVVHGIESMAQGHAIATQVAAMGGVRAAYV
RANLALADEAAGLVAAATQALSAPDILVNNAGIQYTCPIESFPAERWDAILAVNLSAAFH
TMKAAVPGMRERGWGRIVNIASVHGLVASVNKGAYLAAKHGLVGLSKGVALETAAQGITV
NCICPGWTDTAIIQPQIEARAAQFGGDRHAGIRDLLSEKQPNLTLLPPERIGDVTVFLCG
QAGAGITGVALPVDGGWTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaggccacaccgcccttgtcacgggctcaacccagggaattggcctggccatc
gcccacgcgctggcgcgcgccggggccaacgtcgttgtgcacggcatcgagtcgatggcg
caggggcatgccatcgcgacccaagtggctgccatgggcggggtgcgcgccgcctatgtg
cgtgccaacctcgccctcgccgacgaggccgccgggctggtggccgccgccacgcaggct
ctgagcgcgcccgatattctggtcaacaacgcaggcatccagtacacctgcccgatcgag
agttttccagccgaacgctgggacgcgatcctggcggtcaacctgtcggcagcctttcac
accatgaaggcggcggtgccgggcatgcgcgagcgcggctggggccgcatcgtcaacatc
gcctcggtgcacggcttggtggcctcggtcaacaaaggggcatacctggccgccaaacac
ggactggtgggcttgtccaaaggcgtggcgctggaaaccgccgcccaaggcatcactgtc
aattgcatctgcccgggctggaccgacaccgcgatcatccagccgcagatcgaggcgcgc
gccgcccagttcggtggcgaccgccatgcgggcatccgcgacctgctgagcgagaagcag
cccaacctgacgctgttacctcccgaacgcatcggcgatgtgaccgtatttctgtgcggc
caggcaggggcaggcatcaccggcgtggccttgccggtcgatggtggctggacagcgcag
tga

DBGET integrated database retrieval system