KEGG   Rhodoferax ferrireducens: Rfer_3581Help
Entry
Rfer_3581         CDS       T00334                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rfer_3581
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rfer_3581
   00630 Glyoxylate and dicarboxylate metabolism
    Rfer_3581
Enzymes [BR:rfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rfer_3581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3983710..3985968)
Genome map
AA seq 752 aa AA seqDB search
MTERTTRHRLQIATVLQQFIDTQVLPGTGVAPAKFWKGVDAIVADLAPKNIALLAERERL
QTELDSWHAAHPGPINMSDTAAPNSMSAYRAFLEQIGYLVPAPKKARITTTQVDAELAIQ
AGPQLVVPILNARYALNAANSRWGSLYDALYGTDVIDEAKGCEKVGKKGGYNPKRGAKVI
AYARHVLDRTAPLRKGSHVDSVGYRIKDGKLAVKLLDGSNTSLQTPAQLVGYQGDAKAPS
SVLLQHNGLHLDIIINRSTPIGASDPAGVCDLVLEAALSTILDLEDSIAAVDADDKVLAY
SNWLGILQGTLTESVTKGSKTFTRGLNADRLYTPPAGKGKPVVLHGRSLMFVRNVGHLMT
NPAILYTDKAGVTREIPEGILDAVVTTTIAMHDLKRTAKDGIRNSRKGSVYIVKPKMHGP
VEVAFANELFGRVEKMLGLRDSTVKLGIMDEERRTSVNLKACIGAAASRVAFINTGFLDR
TGDEMHSAMQGGAMIRKGDMKTSAWIQAYERNNVLVGLACGLRGKAQIGKGMWAMPDLMK
DMLKQKIAHPLAGANTAWVPSPTGATLHALHYHQVLVSEVQKEMEKINADKQRDNLLTGL
LQVPVAASKNWSAAEIQQELDNNAQGILGYVVRWIDQGVGCSKVPDIHNVALMEDRATLR
ISSQHMANWLHHGVASAAQIKETFERMAAVVDQQNAGDPLYKNMAGHFDTSMAYMAACDL
VFKGLSQPSGYTEPLLHGWRLKVKAAAKAVAV
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgtaccaccaggcaccgcctgcaaattgccactgttttgcagcagttcatc
gacacccaagtgctgcccggcaccggcgtcgccccggccaaattctggaaaggtgttgac
gccatcgtggctgatctggcgccgaagaacatcgccttgctggccgagcgtgagcgcctg
caaaccgagctcgatagctggcacgcggcccaccccggccccatcaatatgagtgacacg
gccgcgccgaacagcatgagcgcctaccgcgcctttctggagcagatcggctacctggtg
ccggcgcccaagaaagcccgcatcaccaccacccaggtcgatgccgagctggccatccag
gccgggccgcagctggtggtgccgatcctgaacgcccgctacgcgctgaacgccgccaac
tcgcgctggggcagtttgtacgacgcgctgtatggcacggacgtgattgacgaagccaag
ggctgtgaaaaagtcggcaagaaaggcggctacaaccccaagcgcggcgccaaagtgatt
gcctacgcgcgccatgtgctcgaccgcaccgcgccgctgcgcaagggctcgcatgtcgat
tcggtcggctaccgcatcaaggacggcaagctggccgtcaagctgcttgatggcagcaac
accagcctgcaaaccccggcgcaattggtcggctaccagggcgacgccaaggcgccgagc
tcggtgctgctgcagcacaacggcctgcacctggatatcatcatcaaccgcagcaccccg
attggtgccagcgaccccgccggtgtctgcgacctggtgttggaagctgcgctctcgacc
attctggacctggaagactcgatcgccgccgtcgacgcggacgacaaagtgctggcctac
agcaactggctgggcatcctgcaaggcacgttgaccgagagcgtgaccaaaggcagcaag
acctttacccgcggcctcaatgccgaccgtctctacaccccgcccgcgggcaagggaaaa
ccagtcgtgttgcacggccgctcgctcatgtttgtgcgcaacgtcggccacctgatgacc
aacccggccattctgtacaccgacaaggcaggcgttacacgtgaaatccccgaaggcatt
ctggacgccgtggtcaccaccaccatcgccatgcatgacctgaagcgcacggccaaggat
ggcatccgcaactcacgcaagggctcggtttacatcgtcaagcccaagatgcacggcccg
gtggaagtcgcgtttgccaacgagctgtttggccgggtcgaaaaaatgctcggcttgaga
gacagcaccgtcaagctcggcatcatggacgaagagcgccgcaccagcgtcaacctgaaa
gcctgcattggcgctgccgccagccgcgtcgccttcatcaacaccggcttcctggaccgc
accggcgacgagatgcacagcgccatgcaaggcggcgccatgatccgcaagggcgacatg
aaaaccagcgcctggattcaggcttacgagcgcaacaacgtgctggtcggcctggcctgc
ggcctgcgcggcaaggcgcagatcggcaaaggcatgtgggccatgccggacctgatgaaa
gacatgctcaagcaaaagatcgctcacccgctcgccggtgccaacaccgcctgggtgccc
agcccgaccggcgccacgctgcacgcgctgcactaccaccaggtgctggtgagcgaggtg
caaaaagaaatggaaaagatcaacgccgacaaacagcgcgacaacctgctgaccggcctg
ctgcaagtgccggtggcggccagtaaaaactggagcgccgccgagatccagcaggagctc
gacaacaacgcccaaggcatcctgggctacgtggtgcgctggatcgaccagggcgtgggc
tgctccaaggtgcccgacatccacaacgtcgccttgatggaagaccgcgccacgctgcgc
atcagcagccagcacatggccaactggctgcaccatggggtggcgagcgcggcgcagatc
aaggaaacgttcgagcgcatggcggcggtggtggaccagcaaaacgcaggcgacccgctg
tacaagaacatggccgggcactttgacaccagcatggcctacatggccgcctgcgatctg
gtgttcaagggcttgagccaaccgagtggctacaccgagccgctgctgcatggctggcgc
ttgaaggtgaaggccgcggccaaggctgtggcggtctaa

DBGET integrated database retrieval system