KEGG   Rhodoferax ferrireducens: Rfer_3884Help
Entry
Rfer_3884         CDS       T00334                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rfer_3884
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rfer_3884
Enzymes [BR:rfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rfer_3884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4335263..4336228
Genome map
AA seq 321 aa AA seqDB search
MNTSAFSPDTALAPGNISLIGVPTDIGAGMLGARMGPEALRVAGLAQALTQLGLDVKDCG
NLHGPANPWLQAVNGFRHLPQVVQWNQLLHEALYCELQARRLPIMLGGDHCLAIGSISAV
ARHCRDQGKKLRVLWFDAHADFNTATLTPSGNIHGMPVACLCGHGPQELIQIGGHVPALQ
PKQIRQIGIRSVDAGEKRLVHDMGIEVFDMRYIDEMGMRHAMELALALVDANTHLHVSLD
VDFLDPAIAPGVGTTVRGGPTYREAQLCMEMIADTGRLASLDVVELNPALDVGNQTAELA
VDLIESLFGKSTLMRSSAAKR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccagcgccttttctcccgacaccgccctcgccccaggcaacatcagtctgatt
ggcgtccccaccgacattggagccggtatgctcggcgcccgcatggggccggaggcactg
cgtgtggcgggcctggcgcaggccctgacgcagttgggtctggatgtcaaagactgcggc
aacctccatggcccggccaacccgtggctgcaggccgtcaacggctttcgccatctgcca
caggtcgtgcagtggaaccagttgctgcatgaggccctgtattgcgaactccaggccagg
cggctgcccatcatgctgggcggcgaccattgcctggccatcggctccatcagcgcggtg
gcacggcactgccgcgaccagggcaagaaactgcgggttttatggtttgacgcgcatgcc
gatttcaacaccgccaccttgacgcccagcggcaacatccacggcatgccggtggcctgc
ctgtgcggccacggcccgcaggaactgatccagattggcggtcatgtcccggccctgcag
cccaagcagattcgccagattggcattcgcagcgtcgatgccggtgaaaagcgcctggtg
cacgacatgggcattgaagtgttcgacatgcgctacatcgatgaaatgggcatgcgccat
gccatggagctggcgttggccctggtggatgccaacacccatttgcacgtcagcctggat
gttgattttctcgacccggcgattgcccccggtgtgggcaccacggtgcggggcggcccg
acctaccgcgaggcacaactgtgcatggagatgattgccgacaccggccggctggcctcg
ctcgacgtggtcgaactcaacccggcgctcgatgtaggcaaccagaccgccgagctggcg
gtggacctgatcgagagcctgtttggcaagagcacactgatgcgttcatccgccgcaaag
cgttag

DBGET integrated database retrieval system