KEGG   Rhodoferax ferrireducens: Rfer_4138Help
Entry
Rfer_4138         CDS       T00334                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
rfr  Rhodoferax ferrireducens
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rfer_4138
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rfer_4138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4611185..4611586
Genome map
AA seq 133 aa AA seqDB search
MPRRHLVPVALFALTTISPGMAAPAAPDAARGQQLYARCAACHALTFDRVGPRHCGLLGR
RAGSVPGFDYSSAMKKSSIVWNEKTLDQFLTNPLVMVPGSSMTYAGVPGASDRADLIAYL
KSANSGAVCRVTP
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccgccatcttgttcccgtcgcgctattcgcgctaacgactatcagcccgggc
atggcggcccctgcagcgccagacgccgcgcgcggccaacagttgtatgcacgctgtgcc
gcgtgccacgcgctgactttcgatcgcgtcgggcccaggcattgcggcttgctgggccgc
cgcgcgggcagcgtgcctggctttgactattcgtcggccatgaagaaatcgagcattgtg
tggaatgaaaagacgctcgatcagtttctgaccaatccgctggtcatggtgcctggcagc
agcatgacctatgctggcgtccccggggccagcgatcgtgccgacctgattgcttacctc
aaatcggccaacagcggagcggtctgtcgtgttacgccataa

DBGET integrated database retrieval system