KEGG   Rubrivivax gelatinosus: RGE_01730Help
Entry
RGE_01730         CDS       T01803                                 

Gene name
bsaA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RGE_01730 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RGE_01730 (bsaA)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RGE_01730 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
182293..182781
Genome map
AA seq 162 aa AA seqDB search
MAATLSDFDAVTIDGQAAPLSAYAGQVVLVVNTASRCGFTPQFAGLEELWQRYRERGLVI
LGFPSNEFGAQDPGTNDEIASFCQLNYGVSFPMMAKVKVNGGDAHPLWRWLTTEARGVLG
TQAVKWNFTKFLVGRDGRVLKRYAPTDAPASLAADIEKALSA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgaccctgtccgatttcgacgccgtcacgatcgacggccaagccgcaccgctg
tccgcctatgccggccaggtggtgctcgtcgtcaacaccgccagccgctgcggcttcacg
ccgcagttcgccgggctcgaggagctgtggcagcgctaccgcgagcgcggcctcgtgatc
ctgggattcccgagcaacgagttcggtgctcaggacccgggcacgaacgacgagatcgcc
tcgttctgccagctcaactacggcgtcagcttcccgatgatggccaaggtgaaggtcaac
ggcggcgacgcgcatccgttgtggcgatggctcaccaccgaggcgcgcggcgtgctcggc
acccaggcggtgaagtggaacttcaccaaattcctcgtcggccgcgacggacgcgtgttg
aagcgttacgcgccgaccgacgccccggcctcgctggccgccgacatcgagaaagcgctt
tcggcatga

DBGET integrated database retrieval system