KEGG   Rubrivivax gelatinosus: RGE_05880Help
Entry
RGE_05880         CDS       T01803                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RGE_05880
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RGE_05880
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RGE_05880
Enzymes [BR:rge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RGE_05880
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGE_05880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612646..614157
Genome map
AA seq 503 aa AA seqDB search
MNRLPFPPAVAIAVLAAATLSACAAAPTAPAPAKPKNVIVMISDGASWNTWEMAANFRSG
ARANDLPEYQLLTERWGVTTFPLNTSTKPTHDATPQVSYDPARAWDPSPVAPVPGDAYAT
AIAGYQYLKRQYTDSAAAGTALASGTKTYNNAINVDNFGQPLDFATRIAHAAGKATGVVT
SVPLAHATPAAFGARNASRSRMTELARDMLRDGNLDLIMGAGHPEHDGNGASVLGLSAAD
CAARTACAKRWDVLAEPEWRELRAGTLRPAGAERPWTLVEDRAEFERLAAGQRRVDGPLL
GIPRVRWTLQQAREEEVLGADPAQPSGVRRIATVPDLATMAGAALRHLERDPDGLFLMIE
GGAVDWAAHANQAGRLVEEQTEFNAALAVVEAWIAAHGGWQQNLLIVTTDHGNAMPMGPQ
SDRVAFQAVPNGGAGVRPAPRFWSDNHTNELVRLWARGAGAERFAEHLRGRDPRFAEVTG
HNDDGRYVDNTDVFRVVKAALER
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcctgccgttcccgcccgccgttgccatcgccgtcctggccgccgccacgctg
tccgcctgcgccgccgcgccgacggcgcccgcaccggccaagccgaagaacgtcatcgtg
atgatcagcgacggcgccagctggaacacctgggagatggcggccaacttccgctccggc
gcccgcgccaacgacctgcccgagtaccaactgctgaccgagcgctggggcgtcacgacc
ttcccgctgaacacctcgaccaagccgacgcacgacgcgacgccgcaggtcagctacgac
ccggcgcgcgcctgggacccgagcccggtggcgccggtgccgggcgatgcctacgccacc
gcgatcgccggctaccagtacctgaagcgccagtacaccgactcggccgccgccggcacc
gcgctggcctcgggcaccaagacctacaacaacgcgatcaacgtcgacaacttcggccag
ccgctggacttcgcgacgcgcatcgcgcacgccgccggcaaggccaccggcgtcgtcacc
tcggtgccgctggcgcacgcgacgccggcggccttcggcgcgcgcaatgccagccgcagc
cgcatgactgagctcgctcgtgacatgctgcgcgacggaaacctcgacctgatcatgggc
gccggccatcccgagcacgacggcaacggcgccagcgtgctcggcctgtcggccgcggac
tgcgccgcgcgcacggcctgcgccaaacgctgggacgtgctcgccgagcccgagtggcgc
gagctgcgcgccggcacgctgcgcccggcgggtgccgaacggccgtggacgctggtcgag
gaccgcgccgagttcgaacgcctggccgccggccagcgccgtgtcgacggcccgctgctc
ggcatcccgcgcgtgcgctggacgctgcagcaggcgcgcgaggaggaagtgctgggcgcc
gacccggcgcagcccagcggcgtgcgccgcatcgccacggtgcccgacctggcgacgatg
gccggcgccgcgctgcgccacctggagcgcgaccccgacggcctgttcctgatgatcgaa
ggcggcgccgtcgactgggcggcgcacgccaaccaggccggccggctggtcgaggagcag
accgagttcaacgccgcgctggccgtcgtcgaggcctggatcgccgcccacggcggctgg
cagcagaacctgctgatcgtcaccaccgaccacggcaatgcgatgccgatggggccgcag
tccgaccgcgtcgccttccaggccgtgcccaacggcggcgccggcgtgcgcccggcgccg
cgtttctggagcgacaaccacaccaacgagctggtgcggctgtgggcgcgcggggccggc
gcggagcgtttcgccgagcatctgcgcggccgcgacccgcgtttcgccgaggtcaccggc
cacaacgacgacggccgctacgtcgacaacaccgacgtcttccgcgtcgtgaaggcggcg
ctggagcgctga

DBGET integrated database retrieval system