KEGG   Rubrivivax gelatinosus: RGE_05880Help
Entry
RGE_05880         CDS       T01803                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rge00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rge00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rge02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612646..614157
Genome map
AA seq 503 aa AA seqDB search
MNRLPFPPAVAIAVLAAATLSACAAAPTAPAPAKPKNVIVMISDGASWNTWEMAANFRSG
ARANDLPEYQLLTERWGVTTFPLNTSTKPTHDATPQVSYDPARAWDPSPVAPVPGDAYAT
AIAGYQYLKRQYTDSAAAGTALASGTKTYNNAINVDNFGQPLDFATRIAHAAGKATGVVT
SVPLAHATPAAFGARNASRSRMTELARDMLRDGNLDLIMGAGHPEHDGNGASVLGLSAAD
CAARTACAKRWDVLAEPEWRELRAGTLRPAGAERPWTLVEDRAEFERLAAGQRRVDGPLL
GIPRVRWTLQQAREEEVLGADPAQPSGVRRIATVPDLATMAGAALRHLERDPDGLFLMIE
GGAVDWAAHANQAGRLVEEQTEFNAALAVVEAWIAAHGGWQQNLLIVTTDHGNAMPMGPQ
SDRVAFQAVPNGGAGVRPAPRFWSDNHTNELVRLWARGAGAERFAEHLRGRDPRFAEVTG
HNDDGRYVDNTDVFRVVKAALER
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcctgccgttcccgcccgccgttgccatcgccgtcctggccgccgccacgctg
tccgcctgcgccgccgcgccgacggcgcccgcaccggccaagccgaagaacgtcatcgtg
atgatcagcgacggcgccagctggaacacctgggagatggcggccaacttccgctccggc
gcccgcgccaacgacctgcccgagtaccaactgctgaccgagcgctggggcgtcacgacc
ttcccgctgaacacctcgaccaagccgacgcacgacgcgacgccgcaggtcagctacgac
ccggcgcgcgcctgggacccgagcccggtggcgccggtgccgggcgatgcctacgccacc
gcgatcgccggctaccagtacctgaagcgccagtacaccgactcggccgccgccggcacc
gcgctggcctcgggcaccaagacctacaacaacgcgatcaacgtcgacaacttcggccag
ccgctggacttcgcgacgcgcatcgcgcacgccgccggcaaggccaccggcgtcgtcacc
tcggtgccgctggcgcacgcgacgccggcggccttcggcgcgcgcaatgccagccgcagc
cgcatgactgagctcgctcgtgacatgctgcgcgacggaaacctcgacctgatcatgggc
gccggccatcccgagcacgacggcaacggcgccagcgtgctcggcctgtcggccgcggac
tgcgccgcgcgcacggcctgcgccaaacgctgggacgtgctcgccgagcccgagtggcgc
gagctgcgcgccggcacgctgcgcccggcgggtgccgaacggccgtggacgctggtcgag
gaccgcgccgagttcgaacgcctggccgccggccagcgccgtgtcgacggcccgctgctc
ggcatcccgcgcgtgcgctggacgctgcagcaggcgcgcgaggaggaagtgctgggcgcc
gacccggcgcagcccagcggcgtgcgccgcatcgccacggtgcccgacctggcgacgatg
gccggcgccgcgctgcgccacctggagcgcgaccccgacggcctgttcctgatgatcgaa
ggcggcgccgtcgactgggcggcgcacgccaaccaggccggccggctggtcgaggagcag
accgagttcaacgccgcgctggccgtcgtcgaggcctggatcgccgcccacggcggctgg
cagcagaacctgctgatcgtcaccaccgaccacggcaatgcgatgccgatggggccgcag
tccgaccgcgtcgccttccaggccgtgcccaacggcggcgccggcgtgcgcccggcgccg
cgtttctggagcgacaaccacaccaacgagctggtgcggctgtgggcgcgcggggccggc
gcggagcgtttcgccgagcatctgcgcggccgcgacccgcgtttcgccgaggtcaccggc
cacaacgacgacggccgctacgtcgacaacaccgacgtcttccgcgtcgtgaaggcggcg
ctggagcgctga

DBGET integrated database retrieval system